PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma9g00520.1
Common NameZOSMA_9G00520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 150aa    MW: 17176.4 Da    PI: 7.8935
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma9g00520.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601261.8e-39101101101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C++dC+lapyfp+++p++fa+vhk+FGa nv ++l++++ +er +a++s++  A +r++dPvyG+vg++++l+qq+e++++el+
  Zosma9g00520.1  10 RCAACKYLRRRCSEDCILAPYFPSTDPQRFACVHKIFGAGNVARMLQQISIHERAEAANSIFQDAYWRIQDPVYGSVGIVSRLHQQIEREQQELV 104
                     6********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++++++
  Zosma9g00520.1 105 RTQAQI 110
                     *99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.2929110IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-3810107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSSINNRSTR CAACKYLRRR CSEDCILAPY FPSTDPQRFA CVHKIFGAGN VARMLQQISI  60
HERAEAANSI FQDAYWRIQD PVYGSVGIVS RLHQQIEREQ QELVRTQAQI AIYTAHNQSI  120
STQLQMNQQQ HESVTFTDIY QLPDFLQIP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412859.11e-54PREDICTED: LOB domain-containing protein 24-like
SwissprotP594682e-45LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A0K9NGQ91e-108A0A0K9NGQ9_Z
STRINGGSMUA_Achr11P04980_0011e-49(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-46LOB domain-containing protein 24