PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma9g00210.1
Common NameZOSMA_9G00210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 568aa    MW: 65093.4 Da    PI: 4.4702
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma9g00210.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.6e-52221482128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka..eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppGfrFhPtd+elv +yLkkk+ +kk+    +i  vd+yk+ePw+Lp+k+++  ++k+w+fF++rd+ky++++r+nr tk+gyWk+tgkd+++++
  Zosma9g00210.1  22 PPGFRFHPTDDELVLYYLKKKICRKKIVD-GMIGVVDVYKWEPWELPEKATNpsRDKQWFFFCPRDRKYPNSSRSNRGTKRGYWKTTGKDRSIYN 115
                     9*************************877.89***************6444444888************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kktLvfy+grapkg++tdWvmhey++
  Zosma9g00210.1 116 -NSRKVGMKKTLVFYEGRAPKGSRTDWVMHEYTI 148
                     .999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-6013171IPR003441NAC domain
PROSITE profilePS5100556.7421171IPR003441NAC domain
PfamPF023651.6E-2722148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MRFVRRNGNS ASSASSSSSR FPPGFRFHPT DDELVLYYLK KKICRKKIVD GMIGVVDVYK  60
WEPWELPEKA TNPSRDKQWF FFCPRDRKYP NSSRSNRGTK RGYWKTTGKD RSIYNNSRKV  120
GMKKTLVFYE GRAPKGSRTD WVMHEYTIEE QELRQFQNIQ ESYAICKVYQ KSGLGPKNGE  180
EYGADFIEEE WADEADHDIL GEKYLEEMMK VDFNGDCNRN AKITGAVPPL SSLETSLLRI  240
DDDPEPSLPS FETLHFQIDD AIEIIREPVD NHSFVQEFET KDETIMRTMV LPPSEEILFS  300
DQIQGTVDTP MTKTLESLEQ ELLRSPDSFL EANNFKEQEL FAPSNDFVEA NDFNDIFQDS  360
NDLVEEHDFN DIFHDSYDFV EENDFNNIFQ DSYYFSDPYM FLSDQFDPNY NGGQLISNGV  420
ENQETSVTTD ELWGHLNLNQ DTSMDHNSVN HAASTPTEVN NTRLVGLEPT ELSSGSFMDQ  480
LLDSVPSRPA FASENNLISR AFVRVSSFRA VRSVTEIEPD GGGSNRQVRR MVNRSGGFLF  540
TSILVCLAFV VWMLLIATVI KVIKYAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-472117115168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9NIW20.0A0A0K9NIW2_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1851269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34180.13e-85NAC domain containing protein 16