PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma99g00690.1
Common NameZOSMA_99G00690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MYB
Protein Properties Length: 839aa    MW: 96279.5 Da    PI: 8.605
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma99g00690.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.65.2e-07402446246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT++Ed+ ++   +  G ++W  Ia ++g++Rt+ qc  r+q 
  Zosma99g00690.1 402 DPWTADEDKNILYIAQTSGIHNWFDIAVRLGTHRTPFQCLVRYQR 446
                      58**************************************99995 PP

2Myb_DNA-binding431.1e-13454499148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++ WT +Ed +l dav  +G + W ++a+++  gRt+ qc +rw+k l
  Zosma99g00690.1 454 KKEWTRDEDAQLCDAVDIFGEN-WQLVASCLE-GRTGPQCSNRWRKTL 499
                      679*****************88.*********.************975 PP

3Myb_DNA-binding50.64.3e-16507551247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      grW+ eEd++l+ av ++G ++W++Ia+  + gRt  qc++rw + 
  Zosma99g00690.1 507 GRWSIEEDKRLKVAVMLFGAKNWNKIAQFAP-GRTQSQCRERWVNC 551
                      8******************************.***********986 PP

4Myb_DNA-binding35.62.2e-11560602347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W +eEd +l  a++++G   W++Ia+ +   Rt+ qc+ rw  +
  Zosma99g00690.1 560 PWEKEEDNKLETAIAKFGYC-WSRIASFLH-PRTDSQCRRRWKVL 602
                      8*****************99.*********.9**********865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.959300395IPR017877Myb-like domain
SMARTSM007173.8E-4304397IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-11306323IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-11367408IPR009057Homeodomain-like
SuperFamilySSF466891.25E-6369409IPR009057Homeodomain-like
PROSITE profilePS500908.455396448IPR017877Myb-like domain
SuperFamilySSF466892.5E-21400495IPR009057Homeodomain-like
SMARTSM007171.2E-5400450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-11409458IPR009057Homeodomain-like
PROSITE profilePS5129411.428449499IPR017930Myb domain
SMARTSM007174.9E-13453501IPR001005SANT/Myb domain
PfamPF002496.9E-11454498IPR001005SANT/Myb domain
CDDcd001678.32E-9456499No hitNo description
Gene3DG3DSA:1.10.10.602.8E-15459505IPR009057Homeodomain-like
PROSITE profilePS5129421.067500556IPR017930Myb domain
SuperFamilySSF466894.58E-27503599IPR009057Homeodomain-like
SMARTSM007171.2E-12505554IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-17507551IPR009057Homeodomain-like
PfamPF002496.7E-15507551IPR001005SANT/Myb domain
CDDcd001673.65E-11508550No hitNo description
Gene3DG3DSA:1.10.10.601.2E-15552602IPR009057Homeodomain-like
SMARTSM007174.6E-12557605IPR001005SANT/Myb domain
PROSITE profilePS5129416.148559607IPR017930Myb domain
CDDcd001672.61E-10560603No hitNo description
PfamPF002492.0E-10560601IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 839 aa     Download sequence    Send to blast
MHVDLSHWTN QDDDSDQEDL ETLRRECLIQ STNSYGGIGE KESRYADSGG ESSDTDDIIL  60
VQKIKQKFSI KDTLDDSNRL SSSCLTISDD DDDFETLRLI KRRFQQYAQV ASSNVNPEKC  120
PDESTLFSTG VTIGQERSVP LLEFPGNSLH IDSDSHSEVN CQTSSPNVEN DHSEFNNWPA  180
QEAAKRFVKP KHVATSSQPF VVALRKNRIC QKFILNKMMQ LETKIEENKF LKEQIKYLMD  240
FQNSCKKRIG KMLSQNKDPR VLLISRSTIS TKVNGGKKAI CGPPENSHVS KYKIVFARSP  300
FSVNKQPWSM SDREKLCKGV KQLYQEMLIT NSIDHDKEKN SIIEYSNTIS SFNDFDMASE  360
NFRSFIPLVN WDRLASMFFT GRTGIECESR WLNYEDPLIN NDPWTADEDK NILYIAQTSG  420
IHNWFDIAVR LGTHRTPFQC LVRYQRSLNA YILKKEWTRD EDAQLCDAVD IFGENWQLVA  480
SCLEGRTGPQ CSNRWRKTLH PDRKRVGRWS IEEDKRLKVA VMLFGAKNWN KIAQFAPGRT  540
QSQCRERWVN CLDPFLNLEP WEKEEDNKLE TAIAKFGYCW SRIASFLHPR TDSQCRRRWK  600
VLFPNEVHLL KAARKMRKTV LISNFVDREK ERPLIGPDDF YYVGKEIIAS DENDEPNKKR  660
RKKSTEEGIK QKRQKKGSTS TDGGIKQKRQ KKGSTSDLRQ LNQPPIVIEK ASKSSLVLHE  720
QPNTFDDIEI PIKKKRGQYK KSLAKRTNCN QSSGNQDVDP AFSSFTDAGS VPVDADQPRL  780
DYISQTVAQL CDKIVLTNDG NLNSEPQTSV NVFLNRTEGV GELSQTISFR KLKQNLRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C4e-263735992155MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-263735992155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197102RLIKRR
2657661KKRRK
3657662KKRRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008793543.10.0PREDICTED: uncharacterized protein LOC103709816 isoform X2
TrEMBLA0A0K9NHQ00.0A0A0K9NHQ0_Z
STRINGGSMUA_Achr6P31410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-151myb domain protein 4r1