PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma8g00040.1
Common NameZOSMA_8G00040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family Dof
Protein Properties Length: 330aa    MW: 35527.4 Da    PI: 6.4976
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma8g00040.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.92.3e-384299461
          zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    k+lkcprC+s ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+ 
  Zosma8g00040.1 42 KSLKCPRCESVNTKFCYYNNYSLSQPRYFCKGCRRYWTQGGSLRNVPVGGGCRKNKRC 99
                    679****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-273098IPR003851Zinc finger, Dof-type
PfamPF027011.8E-324398IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3114498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MVVQSRNHEE DEQGGGELVF MSQIKQDSLH QEKKPKPLPD GKSLKCPRCE SVNTKFCYYN  60
NYSLSQPRYF CKGCRRYWTQ GGSLRNVPVG GGCRKNKRCS PSSSTTTAST TTTTCTTLVA  120
AAAAAAAANA CHNNNAGQFL HQHQLTYEYD PSDLSLAFGR LHAPINPPPL VSLSTTPHYE  180
SGPFVIDSNC NSGQIIHHSP EVPGFLDILR GGFFDANPIA ASGHTNFFYG LGGNLEGEEE  240
NLPFFPIGGE ISNESPQMMK HESPCKSDDG GSFGDRRVDG VQQNWQVGGV DGTTNMMMAG  300
LDSGRDYYWS SGGVGGGGVW HGLVNSSLM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9NJB70.0A0A0K9NJB7_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-33TARGET OF MONOPTEROS 6