PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma84g00210.1
Common NameZOSMA_84G00210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 218aa    MW: 23963.5 Da    PI: 9.7179
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma84g00210.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.33.6e-40551541100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+C+++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r d++sslvyeA++r+rdPvyG++gv+ +lq+q++ ++ el
  Zosma84g00210.1  55 PCAACKLLRRRCTDQCPFSPYFSPQDPNKFASVHKVFGASNVSKMLMDVPETQRFDTASSLVYEANIRLRDPVYGCMGVVASLQRQVQVMEMEL 148
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      ++l+++
  Zosma84g00210.1 149 NKLRTQ 154
                      *99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.74654155IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-4055152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MMLGCKSSAT ATTNFISSAY RDSRHDDGSS KRLKRDLEAP PSSLLQGGVL NTITPCAACK  60
LLRRRCTDQC PFSPYFSPQD PNKFASVHKV FGASNVSKML MDVPETQRFD TASSLVYEAN  120
IRLRDPVYGC MGVVASLQRQ VQVMEMELNK LRTQFMKMRY RYTNNGSTVL PTFHAPMGVA  180
ACRAQSNMPM PTSLSSLPPP PQTLNGNGPQ FSTFGFN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435864.12e-65hypothetical protein CICLE_v10032684mg
RefseqXP_006486213.12e-65PREDICTED: LOB domain-containing protein 15
RefseqXP_010921102.11e-65PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT613e-58LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0K9NLD51e-162A0A0K9NLD5_Z
STRINGPOPTR_0013s08040.11e-62(Populus trichocarpa)
STRINGGSMUA_Achr5P07460_0011e-62(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-59LOB domain-containing protein 13