PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma74g00170.1
Common NameZOSMA_74G00170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 353aa    MW: 39197.9 Da    PI: 4.8893
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma74g00170.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.41.5e-49171441129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      +ppGfrFhPtd e++ +yL++kv +++++   +i +vd++k+ePw+Lp+++k e ke yf+s++dkky+tg+r+nrat  gyWkatgkdk +++
  Zosma74g00170.1  17 MPPGFRFHPTDVEVIYNYLREKVLNENFSP-VAIGDVDLNKSEPWELPSMAKMEGKEHYFYSRKDKKYPTGSRTNRATFYGYWKATGKDKGIYN 109
                      79*************************888.67***************88888999************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +g lvg+kktLvfy+grap+g+kt+Wvm+e+rle
  Zosma74g00170.1 110 GDGYLVGMKKTLVFYNGRAPRGHKTNWVMNEFRLE 144
                      ********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-5514167IPR003441NAC domain
PROSITE profilePS5100552.45517167IPR003441NAC domain
PfamPF023652.2E-2318143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MDMGGDQARE GGLMEMMPPG FRFHPTDVEV IYNYLREKVL NENFSPVAIG DVDLNKSEPW  60
ELPSMAKMEG KEHYFYSRKD KKYPTGSRTN RATFYGYWKA TGKDKGIYNG DGYLVGMKKT  120
LVFYNGRAPR GHKTNWVMNE FRLEGRSLYG LPMLGRDSWV VCRVTHKDGS IGEQKPGAAM  180
IGASITSVEE NYNITNGNNN QLGVNTTTGI FGTPNLPPLM DSSNIMTTAA AFSVTNNRFQ  240
EQYIDTTPPP MYIPTPTVGA TPCFMDHSIQ NPQMNGATPL VQGEGGIEGR EHAPIIGTSP  300
AMSNLEETTD EGSENYQDPA GFDEINRLLF DDNNDLNNTL WPGPHEFKPF PF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-431717017168NO APICAL MERISTEM PROTEIN
1ut4_B2e-431717017168NO APICAL MERISTEM PROTEIN
1ut7_A2e-431717017168NO APICAL MERISTEM PROTEIN
1ut7_B2e-431717017168NO APICAL MERISTEM PROTEIN
3swm_A3e-431717020171NAC domain-containing protein 19
3swm_B3e-431717020171NAC domain-containing protein 19
3swm_C3e-431717020171NAC domain-containing protein 19
3swm_D3e-431717020171NAC domain-containing protein 19
3swp_A3e-431717020171NAC domain-containing protein 19
3swp_B3e-431717020171NAC domain-containing protein 19
3swp_C3e-431717020171NAC domain-containing protein 19
3swp_D3e-431717020171NAC domain-containing protein 19
4dul_A2e-431717017168NAC domain-containing protein 19
4dul_B2e-431717017168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007030224.18e-74PREDICTED: NAC domain-containing protein 92
RefseqXP_021281943.11e-73NAC domain-containing protein 92-like
SwissprotQ9FK448e-73NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0K9NPK40.0A0A0K9NPK4_ZOSMR; NAC domain protein
STRINGEOY107263e-73(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.24e-74Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]