PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma70g00500.1
Common NameZOSMA_70G00500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 342aa    MW: 39279.9 Da    PI: 7.6333
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma70g00500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.24.5e-55401651128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv +yL+ k++++ ++   +i++vd +k+ePwdLp k+k +ekewyfFs rd+ky+tg+r+nrat+sgyWk+tgkdke+++
  Zosma70g00500.1  40 LPPGFRFHPTDEELVAYYLHTKLSDHGFSP-YAIADVDFNKSEPWDLPDKAKIGEKEWYFFSLRDRKYPTGHRTNRATNSGYWKTTGKDKEIFH 132
                      79*************************998.67***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++vg+kktLvfykgrap+gekt+W+mheyr 
  Zosma70g00500.1 133 -GETQVGMKKTLVFYKGRAPRGEKTNWIMHEYRH 165
                      .999****************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6237186IPR003441NAC domain
PROSITE profilePS5100557.1940186IPR003441NAC domain
PfamPF023651.2E-2841164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEDVSHSRRC MQTSSIKREA KEENSIQSLI MEIDNLNQNL PPGFRFHPTD EELVAYYLHT  60
KLSDHGFSPY AIADVDFNKS EPWDLPDKAK IGEKEWYFFS LRDRKYPTGH RTNRATNSGY  120
WKTTGKDKEI FHGETQVGMK KTLVFYKGRA PRGEKTNWIM HEYRHQTKNV YRPPEEEWVV  180
FRIFRKPDSC KKLLLLKSSA LASASSQSYQ APTIDSPCRI NYTTKAGDFI TAVHDGEIPV  240
LYNKKPADVT PPTSFNQFAS TSCNNIISSS RMDMRKNWTS VAEDAVADDQ HQQQYYDSNW  300
PGSLLHESNL LSNSDIFSGE MRFGFYPQGD AFVDNTGRFC K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-54301926171NO APICAL MERISTEM PROTEIN
1ut4_B1e-54301926171NO APICAL MERISTEM PROTEIN
1ut7_A1e-54301926171NO APICAL MERISTEM PROTEIN
1ut7_B1e-54301926171NO APICAL MERISTEM PROTEIN
3swm_A1e-54301929174NAC domain-containing protein 19
3swm_B1e-54301929174NAC domain-containing protein 19
3swm_C1e-54301929174NAC domain-containing protein 19
3swm_D1e-54301929174NAC domain-containing protein 19
3swp_A1e-54301929174NAC domain-containing protein 19
3swp_B1e-54301929174NAC domain-containing protein 19
3swp_C1e-54301929174NAC domain-containing protein 19
3swp_D1e-54301929174NAC domain-containing protein 19
4dul_A1e-54301926171NAC domain-containing protein 19
4dul_B1e-54301926171NAC domain-containing protein 19
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FLR34e-75NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0K9NQJ80.0A0A0K9NQJ8_ZOSMR; NAC domain-containing protein 8
STRINGXP_008807109.12e-83(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-77NAC domain containing protein 38
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]