PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma65g00970.1
Common NameZOSMA_65G00970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 342aa    MW: 38842.4 Da    PI: 6.5084
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma65g00970.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.11.7e-53111401128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeel+ +yL+kkv+ ++++l +vi++vd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+
  Zosma65g00970.1  11 VPPGFRFHPTDEELLYYYLRKKVAYEPIDL-DVIRDVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKD 103
                      69****************************.9***************952444443456*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++ ++ + +g++ktLvfy grap+g+kt+W+mheyrl
  Zosma65g00970.1 104 IHLSNAKRIGMRKTLVFYIGRAPNGQKTEWIMHEYRL 140
                      ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-593164IPR003441NAC domain
PROSITE profilePS5100558.10811164IPR003441NAC domain
PfamPF023655.0E-2812140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MMSAGNGQVT VPPGFRFHPT DEELLYYYLR KKVAYEPIDL DVIRDVDLNK LEPWDLKEKC  60
RIGSGPQNEW YFFSHKDKKY PTGTRTNRAT MAGFWKATGR DKDIHLSNAK RIGMRKTLVF  120
YIGRAPNGQK TEWIMHEYRL NDDNNNNPDQ IQEDGWVVCR LFKKKIHQRE VHQDHAIMED  180
HELQQFNHHM KNNNDPSQLN PNFNHQIPWE YNTIENSMQL PQLLSTESGA AFTFNPSNSL  240
NVTDIECSQN LIKLMGASGG GGADHAESSG ALGFLQHERL NGDWSILDKL LASHQNLDQL  300
IHERDGGGVQ SQQVIDTGAE GVSSTHKFPF QYIGCEGSGK C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-51816514166NO APICAL MERISTEM PROTEIN
1ut4_B4e-51816514166NO APICAL MERISTEM PROTEIN
1ut7_A4e-51816514166NO APICAL MERISTEM PROTEIN
1ut7_B4e-51816514166NO APICAL MERISTEM PROTEIN
4dul_A4e-51816514166NAC domain-containing protein 19
4dul_B4e-51816514166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915633.11e-143NAC domain-containing protein 76
SwissprotQ9MA171e-106SMB_ARATH; Protein SOMBRERO
TrEMBLA0A0K9NT130.0A0A0K9NT13_ZOSMR; Putative NAC domain-containing protein
STRINGXP_010275962.11e-142(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34613781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-107NAC family protein
Publications ? help Back to Top
  1. Fendrych M, et al.
    Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis.
    Curr. Biol., 2014. 24(9): p. 931-40
    [PMID:24726156]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  3. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  4. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]