PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma5g02800.1
Common NameZOSMA_5G02800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 211aa    MW: 22565.7 Da    PI: 8.3982
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma5g02800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.35.4e-4323120198
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC++dCv+apyfp ++p kf  vhk+FGasnv+k+l++l++++r+da++sl++eA++r+rdPvyG+vg+i+ lq+ql++++a+l+
  Zosma5g02800.1  23 PCAACKFLRRKCQPDCVFAPYFPPHNPGKFSSVHKVFGASNVTKILNELKPHQRDDAVNSLAFEADMRLRDPVYGCVGLISFLQHQLREVEAQLH 117
                     7*********************************************************************************************9 PP

          DUF260  96 llk 98 
                     ++k
  Zosma5g02800.1 118 HTK 120
                     887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3622123IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4223119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MASSVTAAAV AGFPSSSSSS SSPCAACKFL RRKCQPDCVF APYFPPHNPG KFSSVHKVFG  60
ASNVTKILNE LKPHQRDDAV NSLAFEADMR LRDPVYGCVG LISFLQHQLR EVEAQLHHTK  120
LELSMYEKCN DKSTVAAAAA GNGLNILLNH QPVGVGPFQP RINHLMHGSP YHDAGITNNM  180
TPSTNVAAPP TGLHFTFAGV DGRHMFIGPT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.13e-58PREDICTED: LOB domain-containing protein 6
RefseqXP_010646844.13e-58PREDICTED: LOB domain-containing protein 6
RefseqXP_010646845.13e-58PREDICTED: LOB domain-containing protein 6
RefseqXP_010646846.13e-58PREDICTED: LOB domain-containing protein 6
SwissprotQ32SG33e-58LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A0K9NWJ41e-156A0A0K9NWJ4_Z
STRINGVIT_00s0340g00090.t019e-58(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.14e-51LOB domain-containing protein 25