PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma59g00400.1
Common NameZOSMA_59G00400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family ARF
Protein Properties Length: 1131aa    MW: 126826 Da    PI: 6.5787
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma59g00400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.69.7e-23126227199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d++  +W++++ yr++++r++lt+GW+ Fv+ ++L +gD+v+F +  ++
  Zosma59g00400.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfSMQPPA-QELVAKDLHDATWTFRHVYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFIR--DE 216
                      99*****************************9445444.38************************************************4..46 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      + +l+++++r+
  Zosma59g00400.1 217 TSQLLLGIRRA 227
                      66679999997 PP

2Auxin_resp123.51.4e-40252334183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aahaa+++s+F+++YnPras+seFvv+++k++ka+++++s+GmRf+m fete+s  rr++Gt++g+sdldp+rW+nS+Wr+L+
  Zosma59g00400.1 252 AAHAAANNSTFTIFYNPRASPSEFVVPLAKYNKAMYTQLSLGMRFRMLFETEESGVRRYMGTITGISDLDPIRWKNSQWRNLQ 334
                      79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.32E-44114255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-41117240IPR015300DNA-binding pseudobarrel domain
CDDcd100173.61E-20125226No hitNo description
PROSITE profilePS5086312.435126228IPR003340B3 DNA binding domain
SMARTSM010193.8E-23126228IPR003340B3 DNA binding domain
PfamPF023626.7E-21126227IPR003340B3 DNA binding domain
PfamPF065072.1E-35252334IPR010525Auxin response factor
PfamPF023091.3E-810001088IPR033389AUX/IAA domain
PROSITE profilePS5174525.18310021086IPR000270PB1 domain
SuperFamilySSF542776.28E-810171080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1131 aa     Download sequence    Send to blast
MKAPGNGIAP DVGDGEKKNI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAATMHKE  60
TDTVPNYTSL PSKLICVLHT VTLHADAETD EVFAQMTLQP VNKYDKESLM ASNIGVKQNK  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQELVAKD LHDATWTFRH  180
VYRGQPKRHL LTTGWSVFVS TKRLLAGDSV LFIRDETSQL LLGIRRANRQ QPSLSSSVLS  240
SESMHIGVLA AAAHAAANNS TFTIFYNPRA SPSEFVVPLA KYNKAMYTQL SLGMRFRMLF  300
ETEESGVRRY MGTITGISDL DPIRWKNSQW RNLQIGWDES TAGERQSRVS IWEIEPVATP  360
YYICPPPFFR PKLPKHPGDE SEPDSSFNRE LPWLGEEIGL KDAQNPLYHG LNLVQWMNMQ  420
RSSQLMTSAS QSPYFPSMMP PTMQNNIVTD DPSKMLNFQT STLPMSSSHL NIPKTNQIQQ  480
FDGFQQTHLS WPQQQQLLLL QQQIPVHPPQ QQIPVHPTQP QISVHLPQQY IQQASGLSQQ  540
QLQQQQQQVA MLPQLHQKQQ QPNICTQQMV QHQQNQQQTE PLQHMRQQQH ELPMQQQSQQ  600
QQIRPSIISP VIADQQQRQP QHFVGQSSPQ QYQSPRAQQQ IQQQSILPQN SGVHQMAHSS  660
NHNLQTSTPQ NMQFQQQIEL QQGLSLRQQQ VTPCQPQLQF QLLQKMQQQQ MLSQMTPYVQ  720
SQLLQQNVGV GAQQNAGVGV QQIAGVQQNP KLPQQQVNGT TLSHSQKELQ SYPNHIDWQI  780
KSGLPITEPS SLANTDLPSC SNSPFNNNQV CSMSLLNNRN SGSAIFSEER EVQTPNNSIV  840
QDINCKSDTR VKHEFHSTKD HDNLTYRNSM VDQLEASSSA NSFCMDRSGE ENYLLPPICL  900
EGEVQPGPRN SIPFGSHVSE LRPDTLLSRG FDAGKDLQNL LSGYGNQKDI ETEISTAGIS  960
SQSFGASDMP FKPGCSNDAV LNDNGVLNRG SWVTTNQPQR MRTYTKVQKR GSVGRSIDVT  1020
RYKGYDELRH DLACMFGING QLEDPHRSEW KLVYVDHEND ILLVGDDPWE EFVGCVQSIK  1080
ILSAAEVQQM SLDGDLGSLP PQQNQAGSGS DNVNLWRGNY DNNSASSFDR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1631635547388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Involved in ethylene responses. Regulates lateral root formation through direct regulation of LBD16 and/or LBD29. Functionally redundant with ARF7. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:16461383, ECO:0000269|PubMed:17259263}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and ethylene. {ECO:0000269|PubMed:16461383}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLA0A0K9NWY30.0A0A0K9NWY3_ZOSMR; Auxin response factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Perilli S, et al.
    RETINOBLASTOMA-RELATED protein stimulates cell differentiation in the Arabidopsis root meristem by interacting with cytokinin signaling.
    Plant Cell, 2013. 25(11): p. 4469-78
    [PMID:24285791]
  3. Sun Y, et al.
    Manipulation of Auxin Response Factor 19 affects seed size in the woody perennial Jatropha curcas.
    Sci Rep, 2017. 7: p. 40844
    [PMID:28102350]
  4. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  5. Olmo R, et al.
    Molecular Transducers from Roots Are Triggered in Arabidopsis Leaves by Root-Knot Nematodes for Successful Feeding Site Formation: A Conserved Post-Embryogenic De novo Organogenesis Program?
    Front Plant Sci, 2017. 8: p. 875
    [PMID:28603536]
  6. Lee K,Seo PJ
    High-temperature promotion of callus formation requires the BIN2-ARF-LBD axis in Arabidopsis.
    Planta, 2017. 246(4): p. 797-802
    [PMID:28766014]
  7. Ayala-Rodríguez JÁ,Barrera-Ortiz S,Ruiz-Herrera LF,López-Bucio J
    Folic acid orchestrates root development linking cell elongation with auxin response and acts independently of the TARGET OF RAPAMYCIN signaling in Arabidopsis thaliana.
    Plant Sci., 2017. 264: p. 168-178
    [PMID:28969797]
  8. Nakamura M, et al.
    Auxin and ROP GTPase Signaling of Polar Nuclear Migration in Root Epidermal Hair Cells.
    Plant Physiol., 2018. 176(1): p. 378-391
    [PMID:29084900]
  9. Hong L, et al.
    Alternative polyadenylation is involved in auxin-based plant growth and development.
    Plant J., 2018. 93(2): p. 246-258
    [PMID:29155478]
  10. Lee K,Park OS,Seo PJ
    Arabidopsis ATXR2 deposits H3K36me3 at the promoters of LBD genes to facilitate cellular dedifferentiation.
    Sci Signal, 2018.
    [PMID:29184030]
  11. Kimura T, et al.
    Asymmetric Auxin Distribution is Not Required to Establish Root Phototropism in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 823-835
    [PMID:29401292]
  12. Schoenaers S, et al.
    The Auxin-Regulated CrRLK1L Kinase ERULUS Controls Cell Wall Composition during Root Hair Tip Growth.
    Curr. Biol., 2018. 28(5): p. 722-732.e6
    [PMID:29478854]
  13. Huang KL, et al.
    The ARF7 and ARF19 Transcription Factors Positively Regulate PHOSPHATE STARVATION RESPONSE1 in Arabidopsis Roots.
    Plant Physiol., 2018. 178(1): p. 413-427
    [PMID:30026290]