PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma59g00170.1
Common NameZOSMA_59G00170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family GRF
Protein Properties Length: 243aa    MW: 26984.3 Da    PI: 8.6427
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma59g00170.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.41.2e-2399142144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrg++rsrk++e
  Zosma59g00170.1  99 DPEPGRCRRTDGKKWRCSKEACQDSKYCERHMHRGKNRSRKPVE 142
                      79***************************************998 PP

2QLQ54.73.1e-192863237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FTa+Q+q+L++Q+l++Ky+a + P+P++L+++i++
  Zosma59g00170.1 28 PFTASQWQELENQALIFKYMACGYPIPSDLILHIRR 63
                     9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-92763IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.3212863IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.1E-132862IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.27499143IPR014977WRC domain
PfamPF088791.4E-19100142IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MMMMMMSGSN GGAGGNSTSN STNNNKYPFT ASQWQELENQ ALIFKYMACG YPIPSDLILH  60
IRRSVLMDST TAASLFPLQP TIGGWGCYQM SGGRKVTEDP EPGRCRRTDG KKWRCSKEAC  120
QDSKYCERHM HRGKNRSRKP VEMSLNTSNS SNNNNSSNGT NTYSGSSSLS IPITPASENN  180
NNNNQPSSYP YGPYSSYSIR PPVMGLATHK DWRLVLCLFD LLIFFIHISY LETTMTTDTT  240
MD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647996.16e-63PREDICTED: growth-regulating factor 1
TrEMBLA0A0K9NWP00.0A0A0K9NWP0_ZOSMR; Growth-regulating factor 1
STRINGOB02G41370.12e-62(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.19e-46growth-regulating factor 5