PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma56g01400.1
Common NameZOSMA_56G01400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 231aa    MW: 25119.5 Da    PI: 8.5895
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma56g01400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.11.9e-40501491100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca +C+++pyf  ++p+kfa vhk++Gasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq++ l+ael
  Zosma56g01400.1  50 PCAACKLLRRRCALECPFSPYFSPHDPQKFASVHKVYGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQVLEAEL 143
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      + l++e
  Zosma56g01400.1 144 NILRAE 149
                      *99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.89749150IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4050147IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MFTGRERGGD DELAKRIKRE EDAPDRMRRS TTTTTQHLVG CQGSLNTLTP CAACKLLRRR  60
CALECPFSPY FSPHDPQKFA SVHKVYGASN VSKMLMEVPE SQRADAANSL VYEANVRLRD  120
PVYGCMGAIS ALQQQVQVLE AELNILRAEI TKHRFRPTNG GNNVIATTSH VHVGGVSVAA  180
LPPIHTRITP PEQASSSSSI YTPPPPSNST TTIPYSSITN DNVINVLYLG *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921102.19e-84PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T51e-66LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0K9NW861e-172A0A0K9NW86_Z
STRINGVIT_13s0067g02380.t011e-81(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-65LOB domain-containing protein 15