PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma53g00110.1
Common NameZOSMA_53G00110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 347aa    MW: 38426.7 Da    PI: 5.2649
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma53g00110.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.82.1e-5391361128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                      lppGfrFhPtdee+++ yL++k  +++++  ++i  vd++k+ePwdLp ++ + +ekewy+F++rd+ky+tg+r+nrat++gyWkatgkdke++
  Zosma53g00110.1   9 LPPGFRFHPTDEEIISSYLREKFLDRNFNP-RAIGVVDLNKCEPWDLPgRAKNIGEKEWYYFCQRDRKYPTGTRTNRATEAGYWKATGKDKEIF 101
                      79*************************999.88***************545556999************************************* PP

              NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++l+g+kktLvfy+grap+gekt+Wv+he+rl
  Zosma53g00110.1 102 DGNNNLIGMKKTLVFYRGRAPRGEKTSWVIHEFRL 136
                      *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-605164IPR003441NAC domain
PROSITE profilePS5100557.3889164IPR003441NAC domain
PfamPF023652.5E-2610136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MARNDLIELP PGFRFHPTDE EIISSYLREK FLDRNFNPRA IGVVDLNKCE PWDLPGRAKN  60
IGEKEWYYFC QRDRKYPTGT RTNRATEAGY WKATGKDKEI FDGNNNLIGM KKTLVFYRGR  120
APRGEKTSWV IHEFRLDNNS YPHPAASRVD RIYDEWVVCR VTHKHADEMT GTNLLSTSAS  180
SSSSSMSLGL PPLMDTCYPN AATHGDHLMS KQSSSSISML NNPPYNNPQY YNLPPNPMNS  240
TFSTGVAEMG GRHPGGGAGE IEGHHEGAIT TPLGGGEVAS KICKEEECST QSLPTSSSTA  300
ISNEMRDIVA PEIGIDRSAF DELDELLSSA GSLGDSLGDM DNFWEW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-46716615167NO APICAL MERISTEM PROTEIN
1ut4_B1e-46716615167NO APICAL MERISTEM PROTEIN
1ut7_A1e-46716615167NO APICAL MERISTEM PROTEIN
1ut7_B1e-46716615167NO APICAL MERISTEM PROTEIN
4dul_A1e-46716615167NAC domain-containing protein 19
4dul_B1e-46716615167NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1249256GGRHPGGG
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FK443e-78NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0K9NWT60.0A0A0K9NWT6_ZOSMR; NAC domain-containing protein 9
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.12e-78Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]