PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma52g01230.1
Common NameZOSMA_52G01230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family Dof
Protein Properties Length: 292aa    MW: 32112.1 Da    PI: 7.9746
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma52g01230.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22e-393594261
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     +++alkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rkn+k+
  Zosma52g01230.1 35 QDQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNIPVGGGCRKNNKR 94
                     7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-283393IPR003851Zinc finger, Dof-type
PfamPF027017.6E-333693IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0593993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MNSSSNSSSG ELIPPCSTRM MPPPAVLERR LRPQQDQALK CPRCDSTHTK FCYYNNYSLS  60
QPRYFCKTCR RYWTKGGSLR NIPVGGGCRK NNKRPPVNGG KKPMHHVTVP EVRHHPPLIL  120
DQGQYHLLNT TLPTASLFGD QRGSGLLPPI TERDLASFME CKYDLSMYDN PDVIDHQNVA  180
GDVERYGPII GNPAAQIFSC ANNGNIIDGY GEIASTVGYH GMSPLGFSIN GSSNHQPSLM  240
STPLSFDGGD DSVHVAGDTK PNGKLLSLEW QDSGRDVGFN AKWTSWDNFH I*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9NZQ10.0A0A0K9NZQ1_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-34Dof family protein