PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma52g00090.1
Common NameZOSMA_52G00090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family ARF
Protein Properties Length: 744aa    MW: 82980.6 Da    PI: 6.7189
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma52g00090.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.2e-24143244199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++p++ ae++       +  ++ s++l+ +d+++++W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + 
  Zosma52g00090.1 143 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyiQ--QRPSQELIAKDLHNKEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RG 232
                      99****************************9543..455679************************************************..44 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                       ++el+++++r+
  Zosma52g00090.1 233 LDGELRLGIRRA 244
                      89999****997 PP

2Auxin_resp103.82.2e-34269350182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +a+a+ tk+vF++++nPr+s+seFvv+++k++++l++++s+GmR+k+ +e ed serr++G+++g+ dld++rWp+S+Wr+L
  Zosma52g00090.1 269 VANAILTKKVFDIYHNPRSSSSEFVVPYWKFLNSLNRSFSIGMRVKVPLECEDTSERRYTGLISGICDLDSIRWPGSQWRCL 350
                      68999****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-41140257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-39140254IPR015300DNA-binding pseudobarrel domain
CDDcd100177.35E-22141243No hitNo description
PfamPF023621.0E-21143244IPR003340B3 DNA binding domain
PROSITE profilePS5086312.901143245IPR003340B3 DNA binding domain
SMARTSM010198.4E-23143245IPR003340B3 DNA binding domain
PfamPF065072.6E-30269350IPR010525Auxin response factor
PROSITE profilePS5174519.435637729IPR000270PB1 domain
SuperFamilySSF542773.53E-7640713No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MRIDLNTIDE KDAAAVALEE EEAKKHTMMS LCLCPELWHA CAGPLVSLPK KGSVVVYFPQ  60
GHLEQICADS AAGHLRFDLP PRVFCRVVDV KLQADASTDE VYAQLSILAD NEVKNHLNHV  120
ESPKDEQDDL PGTTNSPAIP HMFCKTLTAS DTSTHGGFSV PRRAAEDCFP PLDYIQQRPS  180
QELIAKDLHN KEWRFRHIYR GQPRRHLLTT GWSAFVNKKK LVSGDAVLFL RGLDGELRLG  240
IRRASQFKNN MPFSVPYGRN LTPQSFVDVA NAILTKKVFD IYHNPRSSSS EFVVPYWKFL  300
NSLNRSFSIG MRVKVPLECE DTSERRYTGL ISGICDLDSI RWPGSQWRCL IVRWDDDVDP  360
NRQDRVSPWE IQPSSSFSGS SNLSVPGSKR AKMVITSSNP DISVNCGGRG YPDFGGSTRF  420
HRVLQGQEIL GCRTPYDWSD PPNPHHQSDV EGMHHRFSEL ERSVPDVNNC MLGILSSRNV  480
DRVPLGKSKF MYKSMGFDES MSRFNRVLQG QEIVSSKTSA YDGVDDGGNP VSGFFDTNSW  540
NMRAMPRSFN ATAMQQPYYL NSNQPSFSNS NVGNGVQTVL MSDFSERQKD FSDAKTCCRL  600
FGFPLNITAP LGNKQDLSAS SANVLKIDTN QVKPMGRNCT KVYKEGSVVG RPIDLSKLDG  660
YDNLICEIEQ LFGMEGLLND PQNGWHVVYT DVKDGYVMVV GDDPWQEFCR IVSKIMVYAN  720
GDKDSMTNTV TGDGGPGAGV FVH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1142838014361Auxin response factor 1
4ldy_B1e-1142838014361Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924405.10.0auxin response factor 15 isoform X4
RefseqXP_029121019.10.0auxin response factor 15 isoform X3
TrEMBLA0A0K9NXE60.0A0A0K9NXE6_ZOSMR; Auxin response factor
STRINGXP_008798266.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25373580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.11e-180auxin response factor 4