PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma4g01230.1
Common NameZOSMA_4G01230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 116aa    MW: 13083 Da    PI: 8.9128
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma4g01230.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.61.2e-3971061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +C+aCk+lrrkC++dC+lap+fpa++p++f  vhk+FGa nv+++l++lp +ere a++s+ yeA  r++dPvyG +g+i++lq++++++++el+
  Zosma4g01230.1   7 RCSACKYLRRKCSEDCILAPHFPATDPERFVHVHKIFGAGNVSRMLQKLPYNEREVAANSISYEAYLRVQDPVYGIAGTITNLQEEIHRKQQELV 101
                     6*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++k+e
  Zosma4g01230.1 102 RIKAE 106
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9346107IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-377104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MSNKSTRCSA CKYLRRKCSE DCILAPHFPA TDPERFVHVH KIFGAGNVSR MLQKLPYNER  60
EVAANSISYE AYLRVQDPVY GIAGTITNLQ EEIHRKQQEL VRIKAEIAIY TAGNL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927283.12e-45PREDICTED: LOB domain-containing protein 24-like
SwissprotP594687e-40LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A0K9NYL81e-82A0A0K9NYL8_Z
STRINGBGIOSGA013705-PA6e-41(Oryza sativa Indica Group)
STRINGLOC_Os03g57670.16e-41(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.14e-41LOB domain-containing protein 24