PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma4g01150.1
Common NameZOSMA_4G01150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 244aa    MW: 26978.2 Da    PI: 6.2995
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma4g01150.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.69.1e-4315111197
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC++dCv+apyfp +qp+kfa vhk+FGasnv+kll++l++ +reda++sl+yeAe+r+rdPvyG+vgvi +lq++l+q + +l 
  Zosma4g01150.1  15 PCAACKFLRRKCQPDCVFAPYFPPDQPNKFAHVHKVFGASNVTKLLNDLNPCQREDAVNSLAYEAEMRLRDPVYGCVGVIYALQHKLHQISIDLL 109
                     7****************************************************************************************998876 PP

          DUF260  96 ll 97 
                     ++
  Zosma4g01150.1 110 RA 111
                     65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8714115IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4215108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MAAAESGLTS TFNSPCAACK FLRRKCQPDC VFAPYFPPDQ PNKFAHVHKV FGASNVTKLL  60
NDLNPCQRED AVNSLAYEAE MRLRDPVYGC VGVIYALQHK LHQISIDLLR ARLELVKHRP  120
SSAASAASTL PIDEGASGNF PASRADQMRI GGEGLRNMFE GEEFVTPTHI PAAMAECSSS  180
VNQFNQPTVR SYYATELTPH PELDAVGGGN RYDSDELSAI NYIPNYYQKQ NHENQFYNPR  240
IFD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962077.12e-58PREDICTED: LOB domain-containing protein 6-like
RefseqXP_004962078.12e-58PREDICTED: LOB domain-containing protein 6-like
RefseqXP_004962079.12e-58PREDICTED: LOB domain-containing protein 6-like
RefseqXP_012700131.12e-58PREDICTED: LOB domain-containing protein 6-like
TrEMBLA0A0K9NYE60.0A0A0K9NYE6_Z
STRINGSi024114m5e-58(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-55LBD family protein