PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma48g00250.1
Common NameZOSMA_48G00250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 473aa    MW: 54489 Da    PI: 5.9631
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma48g00250.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1561.6e-48151421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      +p Gf FhPtd el+++yLk+k  g ++e+ evi+evdiyk+ePw+Lp k ++ +++ +w+fF + d+ky+tg+r+nrat++gyWk+tgkd+ v
  Zosma48g00250.1  15 MPLGFGFHPTDVELISHYLKRKFMGLNNEI-EVIPEVDIYKYEPWELPgKtRIVSRDCKWHFFNTLDRKYPTGSRSNRATEAGYWKSTGKDRVV 107
                      699************************999.99***************5346666777************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s +++++g+kktLvf++gr p+g++tdW+mhey l
  Zosma48g00250.1 108 RS-QNRAIGTKKTLVFHQGRPPRGKRTDWIMHEYFL 142
                      99.8999***************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-565164IPR003441NAC domain
PROSITE profilePS5100554.36315164IPR003441NAC domain
PfamPF023658.7E-2316141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MMSTTEMDVW DTSSMPLGFG FHPTDVELIS HYLKRKFMGL NNEIEVIPEV DIYKYEPWEL  60
PGKTRIVSRD CKWHFFNTLD RKYPTGSRSN RATEAGYWKS TGKDRVVRSQ NRAIGTKKTL  120
VFHQGRPPRG KRTDWIMHEY FLDENERKSS IAKDIFVLCR VTKRNSLEHE DGDVYNDAKK  180
TNDTCALSRV QKDTPNKIEE QVVEVSNAED ANCEAWVQEL YDPHFSEFLI PVSTCKVEID  240
EVNTNSLEPI SELENSLLPL KNAENVASAN EEYNRYSDFQ DCTMSLYEEL CYFAQLDQEE  300
ILDVQFRKTQ VPSIGEEYPI DKTIETGIHT RDGQTTNIDG NSNNWSKLQA HKMAQKNTEA  360
MSHTVILENS NCHLDVNEFS EHVINNKNAA YYDHGIPFNN KERVFEEPEN HDQTTRRFRD  420
SVKSLIRKAL KDAHVISRRH SHISKRSMLI NGLGGCLTGR IAVMTGLMQE KV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-4721664167NO APICAL MERISTEM PROTEIN
1ut4_B8e-4721664167NO APICAL MERISTEM PROTEIN
1ut7_A8e-4721664167NO APICAL MERISTEM PROTEIN
1ut7_B8e-4721664167NO APICAL MERISTEM PROTEIN
3swm_A7e-4721667170NAC domain-containing protein 19
3swm_B7e-4721667170NAC domain-containing protein 19
3swm_C7e-4721667170NAC domain-containing protein 19
3swm_D7e-4721667170NAC domain-containing protein 19
3swp_A7e-4721667170NAC domain-containing protein 19
3swp_B7e-4721667170NAC domain-containing protein 19
3swp_C7e-4721667170NAC domain-containing protein 19
3swp_D7e-4721667170NAC domain-containing protein 19
4dul_A8e-4721664167NAC domain-containing protein 19
4dul_B8e-4721664167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9P1P00.0A0A0K9P1P0_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75603847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.12e-63NAC domain containing protein 45