PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma461g00020.1
Common NameZOSMA_461G00020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family B3
Protein Properties Length: 375aa    MW: 42910.7 Da    PI: 10.369
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma461g00020.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.64e-1723107196
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                       ffk l   + ++++ l++p+kf+ +hg++k   kt +l +  g++W vk+  +++    +++kGWk+F ++n+L  g f+vF ++g+ +f   
  Zosma461g00020.1  23 FFKPL--LHGFSEK-LSIPRKFL-KHGIQK---KTAKLSNYIGKTWPVKI--QGNVPDLYFGKGWKQFTEDNDLHIGYFLVFCHEGDINF--S 104
                       66777..6677766.********.999874...58***************..999999*************************9887666..4 PP

                       EEE CS
                B3  94 vkv 96 
                       v+v
  Zosma461g00020.1 105 VMV 107
                       544 PP

2B344.62.5e-141692471695
                       EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE....EEE CS
                B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe..lvvk 95 
                       +++p +f e+ g+  ++s +l l+d++++ W v++++  + +r+vlt+GWkeF+ +n+L+ gD v F+l  +++++  l+v+
  Zosma461g00020.1 169 IYVPVDFKEDTGIT-RKS-KLFLKDPKSELWPVEITH-SSNNRTVLTRGWKEFCLSNKLRPGDDVEFQLAPNENGNiiLLVR 247
                       68899998777655.444.9***************54.333469************************99666555114445 PP

3B345.91e-142873661697
                       EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                       l +p+ f+++ g+  e++k  tl++++g+ ++v+l+++ + + ++++ GWk+Fv +n+Lk+ D++ Fkl+  s ++ ++ v+
  Zosma461g00020.1 287 LNIPNAFVAAAGLL-EKPKAATLRNKNGELFDVNLSHQTRNRIHMIG-GWKSFVASNRLKASDVCHFKLKTGSVGNSLFDVR 366
                       789*****999877.58999***************887777778888.********************98667777676665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.31E-1818116IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-1719111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.53420111IPR003340B3 DNA binding domain
CDDcd100178.23E-1621109No hitNo description
SMARTSM010191.7E-1023111IPR003340B3 DNA binding domain
PfamPF023623.9E-1425107IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-16151252IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.88E-17151252IPR015300DNA-binding pseudobarrel domain
CDDcd100174.04E-14152250No hitNo description
PROSITE profilePS5086314.353154252IPR003340B3 DNA binding domain
SMARTSM010192.7E-8154252IPR003340B3 DNA binding domain
PfamPF023622.6E-12168250IPR003340B3 DNA binding domain
PROSITE profilePS5086311.773272371IPR003340B3 DNA binding domain
SMARTSM010196.8E-4275371IPR003340B3 DNA binding domain
SuperFamilySSF1019366.08E-14283370IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.0E-15285369IPR015300DNA-binding pseudobarrel domain
PfamPF023625.5E-12287364IPR003340B3 DNA binding domain
CDDcd100171.04E-13287369No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MSFITDDVLP KNGGNVLPNR PRFFKPLLHG FSEKLSIPRK FLKHGIQKKT AKLSNYIGKT  60
WPVKIQGNVP DLYFGKGWKQ FTEDNDLHIG YFLVFCHEGD INFSVMVLDI TQCQKSYMAT  120
QIAIDENIVN SPDYPTKSEP YKRTTTKICE PPKYTVTLQL RNLKGHYYIY VPVDFKEDTG  180
ITRKSKLFLK DPKSELWPVE ITHSSNNRTV LTRGWKEFCL SNKLRPGDDV EFQLAPNENG  240
NIILLVRIIR KSKRQRLEAI KSRQKCGCNI KDMTFWCTGR ILDQPYLNIP NAFVAAAGLL  300
EKPKAATLRN KNGELFDVNL SHQTRNRIHM IGGWKSFVAS NRLKASDVCH FKLKTGSVGN  360
SLFDVRIKKK NPRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1250255KSKRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9P0590.0A0A0K9P059_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47483264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.11e-37B3 family protein