PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma43g00770.1
Common NameZOSMA_43G00770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 589aa    MW: 65300.4 Da    PI: 4.4137
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma43g00770.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.6e-51171441128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l+pGfrFhPtdeelv++yLk+k+ +k +++ ++i+e+d+yk+ePwdLp k ++++++ ewyfFs+ d+kya+ +r++r+t  gyWk+tgkd+ v
  Zosma43g00770.1  17 LAPGFRFHPTDEELVSYYLKRKIGKKAFKV-DAISELDLYKSEPWDLPeKsRIRSRDMEWYFFSPLDRKYANRSRTSRTTGVGYWKTTGKDRGV 109
                      579***************************.99**************95257788889************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++ +g++vg+kktLvf+ g+apkg++t+Wvmheyr+
  Zosma43g00770.1 110 CR-GGKTVGMKKTLVFHIGKAPKGTRTNWVMHEYRI 144
                      *9.9******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-5911166IPR003441NAC domain
PROSITE profilePS5100557.89217166IPR003441NAC domain
PfamPF023657.7E-2819144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MAPKDPSPSQ ATAAASLAPG FRFHPTDEEL VSYYLKRKIG KKAFKVDAIS ELDLYKSEPW  60
DLPEKSRIRS RDMEWYFFSP LDRKYANRSR TSRTTGVGYW KTTGKDRGVC RGGKTVGMKK  120
TLVFHIGKAP KGTRTNWVMH EYRIVDEEIS GRTQEAEYVV CRIFQKNGPG PQNGAQYGAL  180
FVEEEWEEEE EVEAEVEKKS GLVLTKEQPC DGSVVNFGDN LFMPQDGLLE HEQNNIPSAD  240
CYDSGQNPHN LFQNNKENIN KMAVNCTDIK SQGNDRKDAV SSTRIGDGLF EFNDDINFAE  300
WMGIDGDADG DASDYLELTD FTNIIDADNS STGHENLPLA SQLEQPGTDE VFNTFGENAS  360
FTEPTHTQLP LTDDNLVFPN EMFGDPMMYF DASSDIPTFE LDGSDPFASD MVDEFMTYFD  420
STEDNQFHFS PEGNKTDAQA SEVPMPTTDI ISDFKNENSS VTPEVSSDKS IINKHLESYL  480
GSIPSPPALA SEYPPNGLKS IKFSPSETHP SSSIRLATGT IRLDWSIHKN SVDHRSSLSY  540
GKNDVFGKSQ GIGGGVLSML ISSDFCVSLL SVLFLGITFK LGLCICKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-501616716166NO APICAL MERISTEM PROTEIN
1ut4_B2e-501616716166NO APICAL MERISTEM PROTEIN
1ut7_A2e-501616716166NO APICAL MERISTEM PROTEIN
1ut7_B2e-501616716166NO APICAL MERISTEM PROTEIN
3swm_A2e-501616719169NAC domain-containing protein 19
3swm_B2e-501616719169NAC domain-containing protein 19
3swm_C2e-501616719169NAC domain-containing protein 19
3swm_D2e-501616719169NAC domain-containing protein 19
3swp_A2e-501616719169NAC domain-containing protein 19
3swp_B2e-501616719169NAC domain-containing protein 19
3swp_C2e-501616719169NAC domain-containing protein 19
3swp_D2e-501616719169NAC domain-containing protein 19
4dul_A2e-501616716166NAC domain-containing protein 19
4dul_B2e-501616716166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9P3V90.0A0A0K9P3V9_ZOSMR; NAC domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.17e-80NAC domain containing protein 53