PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma3g01640.1
Common NameZOSMA_3G01640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 66aa    MW: 7490.48 Da    PI: 5.5618
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma3g01640.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26044.15.7e-1415645100
          DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                     +l++lp +ere+a++s+  eA  r++ PvyG vg+i++lq++++++++el+++++e
  Zosma3g01640.1   1 MLQKLPYNEREEAANSISHEAYLRVQHPVYGIVGTITNLQEEIHRKQQELVRIEAE 56 
                     799***********************************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.2E-11153IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089110.411157IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
MLQKLPYNER EEAANSISHE AYLRVQHPVY GIVGTITNLQ EEIHRKQQEL VRIEAEIAIY  60
TAGNL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927283.13e-17PREDICTED: LOB domain-containing protein 24-like
TrEMBLA0A0K9P6762e-40A0A0K9P676_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2753444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-14LOB domain-containing protein 24