PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma373g00070.1
Common NameZOSMA_373G00070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 336aa    MW: 37727.7 Da    PI: 9.7364
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma373g00070.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.2e-5281321128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelv++yL++k++++++ +  +i++vd+yk++Pw+Lp + + +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++ 
  Zosma373g00070.1   8 LPPGFRFHPTDEELVKHYLCRKCTSQSIAV-PIISDVDLYKHDPWQLPGMSSYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIG 99 
                       79*************************999.88***************7777799*************************************9 PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           + +g+kk Lvfy g+apkgekt+W+mheyrl
  Zosma373g00070.1 100 L--PRPIGIKKALVFYVGKAPKGEKTNWIMHEYRL 132
                       9..779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-625158IPR003441NAC domain
PROSITE profilePS5100560.1798158IPR003441NAC domain
PfamPF023657.0E-289132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MSGVELSLPP GFRFHPTDEE LVKHYLCRKC TSQSIAVPII SDVDLYKHDP WQLPGMSSYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGSGYWK ATGADKPIGL PRPIGIKKAL VFYVGKAPKG  120
EKTNWIMHEY RLANVDRSAR KLKSLRLDDW VLCRIYKKGG GGGSGSGNRK TVAVPGSMKA  180
GWMRIPNLPK VENDSTTNMP TMTPTSLSYN TTPQMEPVPA IPQPQQPSIS DYMYLDPLEY  240
STSENGIFNQ FGNDMRNINV IQSNQQQPTR MRDYSNNNYS GSSIENLLPP ASAASEQRFS  300
NSDSANQMRT TTMIPSIFRD DKMLQDVFTF LHKSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-76415811168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008783329.11e-102NAC domain-containing protein 48-like
TrEMBLA0A0K9P5S60.0A0A0K9P5S6_ZOSMR; NAC domain protein
STRINGXP_008783329.11e-101(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-101NAC family protein