PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma36g00050.1
Common NameZOSMA_36G00050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family M-type_MADS
Protein Properties Length: 513aa    MW: 58491.1 Da    PI: 8.4917
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma36g00050.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF658.1e-21952144
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                     kr en s r+vtfskR++gi+KKA+ELS+LCd++ a+++fs+  
  Zosma36g00050.1  9 KRLENASGRHVTFSKRKTGIIKKAKELSILCDIDLALLMFSPAE 52
                     689**************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.969153IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-23181IPR002100Transcription factor, MADS-box
SMARTSM004328.1E-28160IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-17323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-181153IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MGRAKLKIKR LENASGRHVT FSKRKTGIIK KAKELSILCD IDLALLMFSP AEKAILCLGE  60
NSTIDQVLHK FSQQTPQERA KRLYFYPILI IEFLIYQTMM KVLKKTFKKL DHDVNIQDFV  120
GSSFWVKPES VEKLEHIIGI EDYLKHALND LDAQKEMCDR INFANMEGSS SNRFQGGMQS  180
MHMTAQPPMP WIHNNAQHTM LNAQHTNKLP NVISHNLPLA AQNDTHVPRP VQNNTPLDHK  240
DTSRYNIYPT NMEGSSSNQF QGGMQSMHMA AQPPMPWIQN NAQHTILNVQ HIMQLPNVTN  300
HNFPLAAQND THVPRPMQNN TPFDHKDTSR YNIDPANMNG SSSNLFQGGM QSIHMAAQPP  360
MSWIQNNAPH TMINAQHNML LPNVTNHNFP LIAQNDTHVP RPMQNNTPRP LQNNTPRPMQ  420
NNTPRPMQNN THRPMQNNTP LDHKDTSRYN IDPVNFSDFF EINTQDYQLD GSSQDETAVM  480
NLNEMDRHHR SMNMQQQLGG SQHSYQPSSS ST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9P5W10.0A0A0K9P5W1_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-45AGAMOUS-like 30