PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma34g00620.1
Common NameZOSMA_34G00620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family ARF
Protein Properties Length: 659aa    MW: 73448.6 Da    PI: 6.1577
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma34g00620.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.81e-23125225198
                      EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      f+k+lt sd++++g +++ +++a+e+     +++++ s++l+  d++g++W +++i+r++++r++lt+GW+ Fv+a++L +gD ++F   + ++
  Zosma34g00620.1 125 FCKTLTASDTSTHGGFSVLRRHADEClppldMSQQPPSQELVASDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSAKRLVAGDAFIFL--RGDN 216
                      99*****************************55566678*************************************************..3489 PP

                      E..EEEEE- CS
               B3  90 felvvkvfr 98 
                      +el+v+v+r
  Zosma34g00620.1 217 GELRVGVRR 225
                      999***997 PP

2Auxin_resp109.24.4e-36251333183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha+st++ F+v+Y+Pr+s+seF+v+++k+++a ++k+s+GmRfkm+fe+e+ +err+sGt++g+ d  +++W++S+WrsLk
  Zosma34g00620.1 251 ASHAVSTGTLFSVFYKPRTSRSEFIVSLNKYLEARSQKLSIGMRFKMRFEGEEDPERRFSGTITGLGDNASSHWEGSEWRSLK 333
                      789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.16E-44115254IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.9E-41122240IPR015300DNA-binding pseudobarrel domain
CDDcd100175.48E-22123225No hitNo description
PROSITE profilePS5086311.758125227IPR003340B3 DNA binding domain
SMARTSM010194.0E-21125227IPR003340B3 DNA binding domain
PfamPF023621.6E-21125225IPR003340B3 DNA binding domain
PfamPF065077.9E-34251333IPR010525Auxin response factor
PfamPF023094.4E-16538633IPR033389AUX/IAA domain
PROSITE profilePS5174528.585542635IPR000270PB1 domain
SuperFamilySSF542778.83E-13544619No hitNo description
Gene3DG3DSA:3.10.20.2405.6E-4559616No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MSSMAPEGPT SGQSNEMLLR ELWHACAGPL VTVPREGERV YYFPQGHMEQ LEASTQQGLE  60
VDQQVPLFNL PSKILCSVVH VQLQAETETD EVYAQITLQP ELDQGEITSP DPPLPEPERC  120
MVHSFCKTLT ASDTSTHGGF SVLRRHADEC LPPLDMSQQP PSQELVASDL HGNEWHFRHI  180
FRGQPRRHLL TTGWSVFVSA KRLVAGDAFI FLRGDNGELR VGVRRLMRQL NNMPSSVISS  240
HSMHLGVLAT ASHAVSTGTL FSVFYKPRTS RSEFIVSLNK YLEARSQKLS IGMRFKMRFE  300
GEEDPERRFS GTITGLGDNA SSHWEGSEWR SLKVQWDEPS SISRPQRVSQ WELEPLVTSN  360
TPTAQLVSRT KRARSPTLNS IASDLSSAFG MWKPSTDAGN PVSYSPMYRH QEPYSSHSFT  420
PRFSPLSKAN SIAFSVNSNQ PPKSTNQMHW PILKEPHADL FSGSFNNETS EKKQDTGNGY  480
RLFGVQLIEN TTTEETSPLV AMSGFVEDDH PVFSLNAESD RLSQPSTINR SDGLEIEAKQ  540
TRSCTKVHMH GMAVGRAVDL TRMEGYDELL GKLEEMFNIE SELTGSVKKY TIVYTDDEGD  600
MMLVGDDPWS EFCSMVKKIC IYTNEEAKRL SPRKKLPDIT TAMKLGCSSS KSAPSDAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.083569355Auxin response factor 1
4ldw_A0.083569355Auxin response factor 1
4ldw_B0.083569355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026659536.10.0auxin response factor 7-like isoform X1
SwissprotQ6YVY00.0ARFG_ORYSJ; Auxin response factor 7
TrEMBLA0A0K9P7130.0A0A0K9P713_ZOSMR; Auxin response factor
STRINGXP_008786460.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108236116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.20.0auxin response factor 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]