PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma34g00400.1
Common NameZOSMA_34G00400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 149aa    MW: 17595 Da    PI: 9.8525
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma34g00400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.53.1e-5461341128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeelv +yLkkkv +++++l +vi++vd+y++ePwdL+      ++++++wyfFs++dkky+tg+r+nrat +g+Wkatg+dk+
  Zosma34g00400.1   6 VPPGFRFHPTDEELVGYYLKKKVGSERIDL-DVIRDVDLYRIEPWDLQDrcrIRYEQQNDWYFFSHKDKKYPTGTRTNRATLAGFWKATGRDKA 98 
                      69****************************.9***************943532234677*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      v++ k +l+g++ktLvfykgrap+g+ktdW++heyrl
  Zosma34g00400.1  99 VHD-KLRLIGMRKTLVFYKGRAPHGQKTDWIIHEYRL 134
                      **9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-543140IPR003441NAC domain
PROSITE profilePS5100553.3916148IPR003441NAC domain
PfamPF023652.0E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MESSCVPPGF RFHPTDEELV GYYLKKKVGS ERIDLDVIRD VDLYRIEPWD LQDRCRIRYE  60
QQNDWYFFSH KDKKYPTGTR TNRATLAGFW KATGRDKAVH DKLRLIGMRK TLVFYKGRAP  120
HGQKTDWIIH EYRLQTHPNA PPQARAQD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-47613415140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015964229.14e-92NAC domain-containing protein 37
RefseqXP_015964230.14e-92NAC domain-containing protein 37
RefseqXP_025698975.14e-92NAC domain-containing protein 37
RefseqXP_025698976.14e-92NAC domain-containing protein 37
SwissprotQ9SL416e-90NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A0K9P6Y11e-107A0A0K9P6Y1_ZOSMR; NAC domain protein
STRINGVIT_04s0023g03110.t014e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.13e-92vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]