PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma340g00120.1
Common NameZOSMA_340G00120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 321aa    MW: 36426.9 Da    PI: 7.8831
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma340g00120.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.71.1e-53201471128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+v+yL+kk+ + ++++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++
  Zosma340g00120.1  20 LPPGFRFHPTDEELIVHYLEKKAGNLPVPV-SIIAEVDLYKFDPWELPSKANFGEQEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKPIY 111
                       79****************************.89***************99999**************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +  ++++vg+kk Lvfy+g+ pkg+kt+W+mheyrl
  Zosma340g00120.1 112 VCgGQKKVGVKKALVFYSGKPPKGVKTNWIMHEYRL 147
                       9867788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6412181IPR003441NAC domain
PROSITE profilePS5100561.36720181IPR003441NAC domain
PfamPF023651.2E-2721147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MHSNTMESTD SSSCSQQPHL PPGFRFHPTD EELIVHYLEK KAGNLPVPVS IIAEVDLYKF  60
DPWELPSKAN FGEQEWYFFS PRDRKYPNGV RPNRAATSGY WKATGTDKPI YVCGGQKKVG  120
VKKALVFYSG KPPKGVKTNW IMHEYRLVQS STTVAATAPS KPPKRTSLRL DDWVLCRIYQ  180
KNNINVQIRA LDHQTCCIQQ QANYLPHMNS INNTQALVDN DDNFFEGLLA KDAPISNAGR  240
YVDSVPTNRR PPTFLPFYDN QYWTDGGRFR PTVCTIPDSG EMNEHEEGAH VDHQAPTALL  300
DQMMFRQTPY SYISGHNWNP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-721718314167NO APICAL MERISTEM PROTEIN
1ut4_B5e-721718314167NO APICAL MERISTEM PROTEIN
1ut7_A5e-721718314167NO APICAL MERISTEM PROTEIN
1ut7_B5e-721718314167NO APICAL MERISTEM PROTEIN
3swm_A6e-721718317170NAC domain-containing protein 19
3swm_B6e-721718317170NAC domain-containing protein 19
3swm_C6e-721718317170NAC domain-containing protein 19
3swm_D6e-721718317170NAC domain-containing protein 19
3swp_A6e-721718317170NAC domain-containing protein 19
3swp_B6e-721718317170NAC domain-containing protein 19
3swp_C6e-721718317170NAC domain-containing protein 19
3swp_D6e-721718317170NAC domain-containing protein 19
4dul_A5e-721718314167NAC domain-containing protein 19
4dul_B5e-721718314167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. {ECO:0000250}.
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021651908.11e-110NAC transcription factor 56-like
SwissprotA2YMR03e-94NAC10_ORYSI; NAC transcription factor ONAC010
SwissprotQ8GY422e-94NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0K9P7F00.0A0A0K9P7F0_ZOSMR; Putative NAC domain-containing protein
STRINGAquca_059_00027.11e-108(Aquilegia coerulea)
STRINGcassava4.1_010976m1e-108(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-89NAC domain containing protein 25