PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma331g00100.1
Common NameZOSMA_331G00100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 240aa    MW: 27712.1 Da    PI: 6.0693
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma331g00100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.61.5e-3641031100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC+++C++ap+f  ++p+kf  vh++FGasnv kl+++lp e+re+ ++sl yeAe r++dPv+G++g ++kl++ ++++++ 
  Zosma331g00100.1   4 PCAACKFLRRKCTSNCIYAPHFQPDNPAKFSSVHHVFGASNVAKLIQDLPVEKREECVQSLSYEAETRISDPVHGCLGQVMKLHRMIKEADEL 96 
                       7******************************************************************************************99 PP

            DUF260  94 lallkee 100
                       l+++k++
  Zosma331g00100.1  97 LEETKNK 103
                       9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5473104IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-364100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MNSPCAACKF LRRKCTSNCI YAPHFQPDNP AKFSSVHHVF GASNVAKLIQ DLPVEKREEC  60
VQSLSYEAET RISDPVHGCL GQVMKLHRMI KEADELLEET KNKLANYEQQ HLMPLNSSTR  120
VSSEIPPFRL SSIRQNMQPQ NMQPQNRQLQ NMQPQNMQPP STMYGEASGS MMHSINPNTQ  180
TTLPQCHTIN IHPERQQQDL RLMFEHGANV EHDQFQQEQQ HQPFQQNEED EWEFMDDQL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263734.12e-40PREDICTED: LOB domain-containing protein 6-like
TrEMBLA0A0K9P8241e-180A0A0K9P824_Z
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-40LOB domain-containing protein 25