PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma31g00910.1
Common NameZOSMA_31G00910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 355aa    MW: 40408.8 Da    PI: 8.0157
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma31g00910.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.23.1e-5381361128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+ +yLk+++ ++++++ ++i+evdiyk++PwdLp+k+k +++ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++++
  Zosma31g00910.1   8 LPPGFRFHPTDEELILHYLKNRAMSESIQV-SIIAEVDIYKYDPWDLPAKAKFGDREWYFFSPRDRKYPNGVRPNRAAASGYWKATGTDKPIIT 100
                      79****************************.89***************99999****************************************9 PP

              NAM  95 k..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +  + e++g+kk Lvfy+g+ p+g ktdW+mheyrl
  Zosma31g00910.1 101 SsgGYETIGVKKALVFYSGKPPRGDKTDWIMHEYRL 136
                      9777788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-635173IPR003441NAC domain
PROSITE profilePS5100561.5478173IPR003441NAC domain
PfamPF023652.2E-279136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MTNPESSLPP GFRFHPTDEE LILHYLKNRA MSESIQVSII AEVDIYKYDP WDLPAKAKFG  60
DREWYFFSPR DRKYPNGVRP NRAAASGYWK ATGTDKPIIT SSGGYETIGV KKALVFYSGK  120
PPRGDKTDWI MHEYRLSGSP NSSNKIHHHI HMKNKNTSSM RLDDWVLCRI YKKNNTQNTI  180
IQSCEKELRD CSNLEESYLS TLPNLAQQTS NNNFKIPKTS SLTESLEDNN YTMLNRFLFD  240
NPTDISTQQQ QQQMDCSFFN IPTNNFQNNS QAPATYSSSS NSLKRPRAED DYFETESSSG  300
VVAGSGDLHH PLRSFHNSSL NSSVNFSNQM MGLPQYNSNI YNHQLSLNSH LGLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-72517512170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922870.11e-107NAC domain-containing protein 2
SwissprotQ8H4S49e-85NAC10_ORYSJ; NAC domain-containing protein 10
TrEMBLA0A0K9P8W10.0A0A0K9P8W1_ZOSMR; NAC domain protein
STRINGXP_008782759.11e-103(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.19e-82NAC domain containing protein 25
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]