PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma31g00900.1
Common NameZOSMA_31G00900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 382aa    MW: 43435.9 Da    PI: 5.522
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma31g00900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.66e-54191451128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtd e+++eyLkkk  +++ +  ++i evd++k+ePwdLp+k+k +e+ewyf+ ++d+ky+tg r+nratk+gyWkatgkdk++++
  Zosma31g00900.1  19 LPPGFRFHPTDLEVIDEYLKKKNLQRSYNP-RAIGEVDLNKCEPWDLPSKAKMGENEWYFYYQKDRKYPTGLRTNRATKAGYWKATGKDKPIYK 111
                      79*************************888.78***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       k++l+g+kktLvfykgrapkgekt+Wvmhe+rl
  Zosma31g00900.1 112 GKRNLIGMKKTLVFYKGRAPKGEKTNWVMHEFRL 145
                      999*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5917173IPR003441NAC domain
PROSITE profilePS5100556.39819172IPR003441NAC domain
PfamPF023658.1E-2620145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEGISEAMTP RDADFINELP PGFRFHPTDL EVIDEYLKKK NLQRSYNPRA IGEVDLNKCE  60
PWDLPSKAKM GENEWYFYYQ KDRKYPTGLR TNRATKAGYW KATGKDKPIY KGKRNLIGMK  120
KTLVFYKGRA PKGEKTNWVM HEFRLQSGNP TYTPNISQNQ KPEWVVCKIF HKNTDAIVNK  180
SDSLKTMMKT TSSAATFTSN PLPIGYNFDT SVIPQMVDIS HSYPTTNYIN NYIDAYNSGC  240
IDYSSTAAIN DIQNQQYYYP KTTSFAPYCD NLSFPNPQMT EIDISSPAQY VGTPIEIKPQ  300
PTPSISLTPM DKLMAVKQYM DKEEENVGDY YNNILPPVMS SPEMGIVDDG ESNEGLEVFL  360
NFIETKNEWP GSIYDSGAAY N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-47111757171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009403845.11e-80PREDICTED: NAC domain-containing protein 92-like
RefseqXP_009403846.11e-80PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FK444e-76NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0K9PB710.0A0A0K9PB71_ZOSMR; NAC domain-containing protein 7
STRINGGSMUA_Achr6P08600_0016e-80(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.21e-79Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]