PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma31g00810.1
Common NameZOSMA_31G00810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family ZF-HD
Protein Properties Length: 131aa    MW: 14298.2 Da    PI: 8.8639
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma31g00810.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.22.5e-3060116360
      ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                      kv Y+eC+kNhAas+G havDGC+Efm+s geegta al+CaAC CHR+FH+reve +
  Zosma31g00810.1  60 KVWYRECRKNHAASVGRHAVDGCREFMAS-GEEGTAGALNCAACSCHRSFHKREVERQ 116
                      789*************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2156123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.7E-2861113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-2563113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.62463112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MPTSSSPSLH ISKSRAKVTP NHKTVELVVD QHHHLLMKIQ QDLSYKLIAG DINGSMLVNK  60
VWYRECRKNH AASVGRHAVD GCREFMASGE EGTAGALNCA ACSCHRSFHK REVERQVLGD  120
CSSNTASPRS *
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931461.24e-30mini zinc finger protein 2
RefseqXP_015069508.13e-30mini zinc finger protein 2-like
SwissprotQ9LJW57e-27MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A0K9P8V32e-92A0A0K9P8V3_ZOSMR; Uncharacterized protein
STRINGGorai.006G017300.13e-29(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-29mini zinc finger 2
Publications ? help Back to Top
  1. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]