PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma2g03630.1
Common NameZOSMA_2G03630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family M-type_MADS
Protein Properties Length: 186aa    MW: 21423.1 Da    PI: 9.6546
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma2g03630.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF404.9e-131053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    r e+  nr +t+ kR +gi KK + LS  Cd++v v++f ++gk
  Zosma2g03630.1 10 RLESALNRRITYGKRMKGIAKKVKDLSHVCDVDVVVLMFHPNGK 53
                    6799**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.22E-18178IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-13160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.6153IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-11323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-121253IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MGRQKVKIAR LESALNRRIT YGKRMKGIAK KVKDLSHVCD VDVVVLMFHP NGKKATLCLG  60
ENRELLPILE RYSKIGIQER EGRIRESQDL VKKMMRKIGH DVETQTPQPS MDESESLEEK  120
AEKLKNKIKD VQEKINMATY RLSCWESPET VTNMDMLDDM EIIVRKNLQQ LKLQKESMIV  180
NEPAV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PBK31e-132A0A0K9PBK3_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.28e-30AGAMOUS-like 30