PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma2g02980.1
Common NameZOSMA_2G02980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family M-type_MADS
Protein Properties Length: 479aa    MW: 54011.8 Da    PI: 7.2358
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma2g02980.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.52e-19953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    kr en   rqvtfskRr+gi KKA ELS+LCd++ a+++f + gk
  Zosma2g02980.1  9 KRLENAGGRQVTFSKRRAGIVKKATELSILCDIDLALLMFPPAGK 53
                    6889999*********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.137153IPR002100Transcription factor, MADS-box
SMARTSM004326.0E-28160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-23292IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-171253IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MGRAKLKIKR LENAGGRQVT FSKRRAGIVK KATELSILCD IDLALLMFPP AGKAIMCLGE  60
NSTMDQVLHK FSQQTPQERA KRKLESLEIY QTMMKVLKKT FKKLDHDVNI QDFVGSSFWV  120
KPESVDKLEH ITRIEDYLRQ ALNDLDAQKE MCDRINFANM EGSSSNQFQG GMQSMHMAAQ  180
PPMPWIQNNA QHTMLNAQHT NKLPNVTSHN FPLAAQNDTH VPRLVQNNTP LDHKDTSKYN  240
IDPANMEGSS SNQFQGGMQS MHMAAQPPVP WIQNNAQYTI LNVQHTMQLP NVTNHNFPLA  300
AQNDIHVPHP MQNNTPLDHK DTSRYSIHPA NMEGSSSNQF QGGMQSMHMA AQPPIPWIHN  360
NAQHTMLNAQ HTMLLPNVTN HNFPLAPQND THVPRPMQNN TPLDHKDTSS YNIDPMNFSD  420
FFGINTQDYQ LDGSSQAETA VMNLNEMGHH QHSMNMQQQL GSGQHSYQPS SSFNMNTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-14188186Myocyte-specific enhancer factor 2B
1tqe_Q6e-14188186Myocyte-specific enhancer factor 2B
1tqe_R6e-14188186Myocyte-specific enhancer factor 2B
1tqe_S6e-14188186Myocyte-specific enhancer factor 2B
6c9l_A6e-14188186Myocyte-specific enhancer factor 2B
6c9l_B6e-14188186Myocyte-specific enhancer factor 2B
6c9l_C6e-14188186Myocyte-specific enhancer factor 2B
6c9l_D6e-14188186Myocyte-specific enhancer factor 2B
6c9l_E6e-14188186Myocyte-specific enhancer factor 2B
6c9l_F6e-14188186Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PBF10.0A0A0K9PBF1_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.26e-54AGAMOUS-like 30