PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma2g02340.1
Common NameZOSMA_2G02340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family GRF
Protein Properties Length: 330aa    MW: 37037.6 Da    PI: 8.5415
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma2g02340.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.79.7e-2489131244
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      epgrCrRtDGKkWRCs+++ +++k+CErH+hrg++rsrk++e
  Zosma2g02340.1  89 LEPGRCRRTDGKKWRCSKEAHPDSKYCERHMHRGKNRSRKPVE 131
                     69**************************************998 PP

2QLQ55.41.9e-191447235
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35
                    +FTa Q+q+L++Q+l+yKy+a++ P+P++L+++ 
  Zosma2g02340.1 14 PFTAVQWQELEHQALIYKYMASGHPIPADLILPM 47
                    9*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.9E-101349IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.261449IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-141447IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.36688132IPR014977WRC domain
PfamPF088793.4E-2090131IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MVMNGSGNGG SRYPFTAVQW QELEHQALIY KYMASGHPIP ADLILPMRRS VLLDTGVGAV  60
ASMFPHQQQP NIGWGCGFQM GYGRKVEDLE PGRCRRTDGK KWRCSKEAHP DSKYCERHMH  120
RGKNRSRKPV ETLLAAAPAG RNREEESSAS GYVPTLYPRT QNHPAFPYSF GMRKEVVDQY  180
KCSSDSRASV IAERNRDGSG SWTFTPLGMG LSEPNNNNKP PLLFPKPVDD VCHNGEDQQK  240
KRRQGPYCFV LSDDFKLQTP KDEDGGEGYG VEEVKKEESQ KPLGCFFGDW LLKKKEPSPS  300
PSSWIDLEED RSFSKTQLSM STPRSHFSP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PB920.0A0A0K9PB92_ZOSMR; Growth-regulating factor 1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-48growth-regulating factor 5