PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma29g00760.1
Common NameZOSMA_29G00760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 325aa    MW: 37314.7 Da    PI: 5.4991
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma29g00760.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1775.2e-55201471129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhP dee++++yL +kv ++++++ ++i evd++k+ePwdLp k+k +ekew+fF++rd+ky+tg r+nrat++gyWkatgkdke+++
  Zosma29g00760.1  20 LPPGFRFHPMDEEIITHYLWEKVLDNSFTA-TAIGEVDLNKCEPWDLPGKAKMGEKEWFFFCQRDRKYPTGMRTNRATEAGYWKATGKDKEIFK 112
                      79*************************999.88***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       kg+l+g+kktLvfy+grapkgekt+Wv+he+rle
  Zosma29g00760.1 113 GKGNLIGMKKTLVFYTGRAPKGEKTNWVIHEFRLE 147
                      ********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6115171IPR003441NAC domain
PROSITE profilePS5100558.0920171IPR003441NAC domain
PfamPF023656.4E-2721146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MNMMEGDGDG DHHGHGSLCL PPGFRFHPMD EEIITHYLWE KVLDNSFTAT AIGEVDLNKC  60
EPWDLPGKAK MGEKEWFFFC QRDRKYPTGM RTNRATEAGY WKATGKDKEI FKGKGNLIGM  120
KKTLVFYTGR APKGEKTNWV IHEFRLEGKS SYNRLPPNSM YEWVVCRVFH KDSEIKMIRS  180
SCESNEMMMM MMARGNTFSM NSSLVDEFLV SPTLPPLVET STDHHHHQDQ DHDYTTTITT  240
TMDPNSSTSQ FYTHHNQPFL TDTQNNNYNF DQMPDYSHQT TLQMSVASQE TAMSTDQNPE  300
ISSLGLEIGC GHYYDDDGFE NLWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-531817318170NAC domain-containing protein 19
3swm_B2e-531817318170NAC domain-containing protein 19
3swm_C2e-531817318170NAC domain-containing protein 19
3swm_D2e-531817318170NAC domain-containing protein 19
3swp_A2e-531817318170NAC domain-containing protein 19
3swp_B2e-531817318170NAC domain-containing protein 19
3swp_C2e-531817318170NAC domain-containing protein 19
3swp_D2e-531817318170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020276002.11e-100NAC domain-containing protein 79-like
RefseqXP_021658802.11e-99NAC domain-containing protein 92-like
SwissprotQ9FK445e-94NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0K9PDU30.0A0A0K9PDU3_ZOSMR; NAC domain-containing protein 4
STRINGEOY107261e-98(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.25e-93Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]