PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma296g00130.1
Common NameZOSMA_296G00130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family M-type_MADS
Protein Properties Length: 452aa    MW: 51223.5 Da    PI: 7.2118
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma296g00130.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.54.6e-20952144
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                      kr en   r+vtfskR++gi+KKA+ELS+LCd++ a+++fs+  
  Zosma296g00130.1  9 KRLENAGGRHVTFSKRKTGIIKKAKELSILCDIDLALLMFSPAE 52
                      6889999**********************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.7E-27160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.23E-22181IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.591153IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-16323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-171253IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MGRAKLKIKR LENAGGRHVT FSKRKTGIIK KAKELSILCD IDLALLMFSP AEKAILCLGE  60
NSTIDQVLHK FSQQTPQERA KSFWVKPESV EKLEHIIGIE DYLKHALNDL DAQKEMCDRI  120
NFANMEGSSS NRFQGGMQSM HMAAQPPMPW IQNNTQHTML NAQHTNKLPN VISHNFPLAA  180
QNDTHVPRPV QNNTPLDHKD TSRYYIYPTN MEGSSSNQFQ GGMQSMHMAT QPPMPWIQNN  240
AQHTILNVQH TMQLPNVTNH NFPLAAQNDT HVPRPMQNNT PLDHKDTSRY NIDPANMKGS  300
SSNLFQGGMQ SIHMAAQPPM SCIQNNAQHT MINAQHTMLL PNVTNHNFPL IAQNDTHVPR  360
PMQNNTPRPM QNNTPLDHKD TSRYNIDPVN FSDFFEINTQ DYQLDDSSQD ETAVMNLNEM  420
DHHHRSMNMQ QQLGGSQHSY QPSSSFNMNT Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A2e-14195193MEF2 CHIMERA
6bz1_B2e-14195193MEF2 CHIMERA
6bz1_C2e-14195193MEF2 CHIMERA
6bz1_D2e-14195193MEF2 CHIMERA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PE890.0A0A0K9PE89_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.29e-34AGAMOUS-like 30