PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma27g00270.1
Common NameZOSMA_27G00270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family ARF
Protein Properties Length: 860aa    MW: 96004.5 Da    PI: 7.1086
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma27g00270.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.89.8e-24165266199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++ +++a+e+      g++ + +++l+ +d++g +W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + +
  Zosma27g00270.1 165 FCKTLTASDTSTHGGFSVLRRHADEClppldmGKQ-PPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGE 255
                      99*****************************6444.45569************************************************..449 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+v+v+r+
  Zosma27g00270.1 256 NGELRVGVRRA 266
                      999*****996 PP

2Auxin_resp118.45.9e-39291373183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha+st+++F v+Y+Pr+s+seF+v++++++++lk++ s+GmRfkm+fe+e+++e+r++Gt+vg+sd+d+ rW++SkWrsLk
  Zosma27g00270.1 291 AWHAVSTGTMFIVYYKPRTSPSEFIVPYDQYMESLKNNHSIGMRFKMRFEGEEAPEQRFTGTIVGISDADSGRWSGSKWRSLK 373
                      89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.9E-40157280IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.26E-38161294IPR015300DNA-binding pseudobarrel domain
CDDcd100172.19E-21163265No hitNo description
PfamPF023621.4E-21165266IPR003340B3 DNA binding domain
PROSITE profilePS5086311.815165267IPR003340B3 DNA binding domain
SMARTSM010193.0E-23165267IPR003340B3 DNA binding domain
PfamPF065073.9E-36291373IPR010525Auxin response factor
PROSITE profilePS5174522.873733826IPR000270PB1 domain
SuperFamilySSF542771.28E-11735810No hitNo description
PfamPF023091.4E-6779814IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 860 aa     Download sequence    Send to blast
MTPTSGASQK GNYADGRGES FSSGSSEMND GVKNTVVSDV NRGLSDACPP PVSGKDFDSA  60
FYDELWHACA GPLVTVPKQG EKVYYFPQGH IEQVEASTNQ VANQQMPMYN LQPKILCRVM  120
NVVLKAEPDT DEVFAQITLL PEEDDNTGEK EPPPVVHPRT RVRSFCKTLT ASDTSTHGGF  180
SVLRRHADEC LPPLDMGKQP PTQELVAKDL HGVEWRFRHI FRGQPRRHLL QSGWSVFVSS  240
KRLVAGDAFI FLRGENGELR VGVRRAMKHQ ANVPSSVISS HNMHLGVLAT AWHAVSTGTM  300
FIVYYKPRTS PSEFIVPYDQ YMESLKNNHS IGMRFKMRFE GEEAPEQRFT GTIVGISDAD  360
SGRWSGSKWR SLKVRWDENS SISRPERVSP WKIEPASTPP LNPVPAPRNK RARANHVFPL  420
SNSSSFVTTR DGTKTFVDSH MHEISKVLQG QETKSLHSVF AHDVESEISQ RPTSWIGESK  480
NDGNCQSRLG KTSWKSGARN EPMYSNMLTG FNVSGDTQGL SSVLRRTHED NGPSKNHHQE  540
QDGKFTLLSK PWLMQSNVLD VDRRWESSNQ INVLPNQKID SSRYGGHGYL SLQSYGIDHS  600
TNWSSPKLPP NHIIEGPIKP ILRRPQPCIL KKSELPKVKG SGNCRIFGFQ LNSNPEILDL  660
ETTHINAAHV SDSHSHPASI HQGSGFEIDQ HTDECKGNNS TDSDLVRKEQ VHRLQSSTPT  720
SKDASKPCHG SARSCTKVHK QGIALGRSVD LTKFIDYDQL IDELDLMFDF KGELKPPNKN  780
WVIVYRDNEN DMMLVGDDPW QEFCCIVRKI CIYTPEEVQR MNPGTLSPKI EDGEADISEE  840
RNTATNGTWE SSPSPMADS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1725439812357Auxin response factor 1
4ldw_A1e-1725439812357Auxin response factor 1
4ldw_B1e-1725439812357Auxin response factor 1
4ldx_A1e-1725439812357Auxin response factor 1
4ldx_B1e-1725439812357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Functions independently of ethylene and cytokinin response pathways. May act as a repressor of cell division and organ growth. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:15960614, ECO:0000269|PubMed:16176952, ECO:0000269|PubMed:16339187}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010942378.10.0auxin response factor 23
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A0K9PFI00.0A0A0K9PFI0_ZOSMR; Auxin response factor
STRINGXP_010249208.10.0(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117836111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV
    Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula).
    PLoS ONE, 2012. 7(8): p. e42839
    [PMID:22916167]
  2. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  3. Li C, et al.
    Ectopic expression of a maize hybrid down-regulated gene ZmARF25 decreases organ size by affecting cellular proliferation in Arabidopsis.
    PLoS ONE, 2014. 9(4): p. e94830
    [PMID:24756087]
  4. Lyons R, et al.
    Fusarium oxysporum triggers tissue-specific transcriptional reprogramming in Arabidopsis thaliana.
    PLoS ONE, 2015. 10(4): p. e0121902
    [PMID:25849296]
  5. Roodbarkelari F,Du F,Truernit E,Laux T
    ZLL/AGO10 maintains shoot meristem stem cells during Arabidopsis embryogenesis by down-regulating ARF2-mediated auxin response.
    BMC Biol., 2015. 13: p. 74
    [PMID:26358077]
  6. Meng LS,Wang ZB,Yao SQ,Liu A
    The ARF2-ANT-COR15A gene cascade regulates ABA-signaling-mediated resistance of large seeds to drought in Arabidopsis.
    J. Cell. Sci., 2015. 128(21): p. 3922-32
    [PMID:26395398]
  7. Zhao S,Zhang ML,Ma TL,Wang Y
    Phosphorylation of ARF2 Relieves Its Repression of Transcription of the K+ Transporter Gene HAK5 in Response to Low Potassium Stress.
    Plant Cell, 2016. 28(12): p. 3005-3019
    [PMID:27895227]
  8. Promchuea S,Zhu Y,Chen Z,Zhang J,Gong Z
    ARF2 coordinates with PLETHORAs and PINs to orchestrate ABA-mediated root meristem activity in Arabidopsis .
    J Integr Plant Biol, 2017. 59(1): p. 30-43
    [PMID:28074634]
  9. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  10. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  11. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]
  12. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  13. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]
  14. Sarkar Das S, et al.
    Expression dynamics of miRNAs and their targets in seed germination conditions reveals miRNA-ta-siRNA crosstalk as regulator of seed germination.
    Sci Rep, 2018. 8(1): p. 1233
    [PMID:29352229]