PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma27g00160.1
Common NameZOSMA_27G00160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LFY
Protein Properties Length: 454aa    MW: 50037.8 Da    PI: 7.4108
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma27g00160.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY582.31.2e-17714181385
          FLO_LFY   1 mdp.eafsaslfkwdpraaa........aapparlleeaavseap.leaaaaaaarklr................eleelfkayGvryltvaki 68 
                      mdp +afsas+f+wdpr+a+        + +p++ +++++++ ++ ++++++++a                    el+e+f++yGvry+tv +i
  Zosma27g00160.1   1 MDPsDAFSASMFRWDPRTAVgfyggpplT-SPQQQQQQQHQQMQQvQQQQQQQQA---ApisggggvvgrlvvvrELDEIFQSYGVRYATVERI 90 
                      676256***********999887655432.2222222222211111222222222...13447889999999999******************* PP

          FLO_LFY  69 aelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrk......llsedeetaldalsqeglseepvqe 156
                       elGft+stLv+mkd+e+dd+m +l+++fr++llvGeryGikaavr errr++ +  + +r++      ++  d++  ldalsqeglseepvq+
  Zosma27g00160.1  91 RELGFTASTLVGMKDDEIDDMMGTLCHLFRWELLVGERYGIKAAVREERRRVDFTV-DGRRNTgaapasFFRGDSHYILDALSQEGLSEEPVQQ 183
                      ****************************************************9854.4555444455446699********************* PP

          FLO_LFY 157 ekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeeg......sgedgeerqrehPfivtepgevarg 244
                       +eaagsgge  g  +++++++++ +++kk+ +++k +++kk  + +++ded  ++ed+d+++      s+++g erqrehPfivtepgevarg
  Zosma27g00160.1 184 DNEAAGSGGEVGGGGHKIKQKQRRGSSSKKSPTQQKPRKQKKVVVLEDDDEDIGDDEDDDGSKsggcggSSTGGGERQREHPFIVTEPGEVARG 277
                      *******99997666666666554444444443434444443333344444444444444444555554556677******************* PP

          FLO_LFY 245 kknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrq 338
                      kknGLDYLf+L++qCrefL+qvq+ ake+GekcP+kvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdee sn+lrr+fkergenvGawr 
  Zosma27g00160.1 278 KKNGLDYLFHLFDQCREFLIQVQNQAKENGEKCPSKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEVSNELRRTFKERGENVGAWRL 371
                      ********************************************************************************************** PP

          FLO_LFY 339 acykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                      acy+plv ia++++wdidavf+ahprL++WYvPt LrqLCh +rs+a
  Zosma27g00160.1 372 ACYRPLVLIASHHAWDIDAVFAAHPRLAVWYVPTTLRQLCHHARSNA 418
                      ********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016983.3E-1761419IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MDPSDAFSAS MFRWDPRTAV GFYGGPPLTS PQQQQQQQHQ QMQQVQQQQQ QQQAAPISGG  60
GGVVGRLVVV RELDEIFQSY GVRYATVERI RELGFTASTL VGMKDDEIDD MMGTLCHLFR  120
WELLVGERYG IKAAVREERR RVDFTVDGRR NTGAAPASFF RGDSHYILDA LSQEGLSEEP  180
VQQDNEAAGS GGEVGGGGHK IKQKQRRGSS SKKSPTQQKP RKQKKVVVLE DDDEDIGDDE  240
DDDGSKSGGC GGSSTGGGER QREHPFIVTE PGEVARGKKN GLDYLFHLFD QCREFLIQVQ  300
NQAKENGEKC PSKVTNQVFR YAKKSGASYI NKPKMRHYVH CYALHCLDEE VSNELRRTFK  360
ERGENVGAWR LACYRPLVLI ASHHAWDIDA VFAAHPRLAV WYVPTTLRQL CHHARSNAAV  420
NVNATVSASG AAPPSSSVHH GGCAGNNGLP ALF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1012574472191PROTEIN LEAFY
2vy2_A1e-1012574472191PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436969.11e-160floricaula/leafy homolog
RefseqXP_006485166.11e-160floricaula/leafy homolog
SwissprotO485591e-152UNI_PEA; Protein UNIFOLIATA
TrEMBLA0A0K9PDB00.0A0A0K9PDB0_ZOSMR; Protein UNIFOLIATA
STRINGXP_006485166.11e-159(Citrus sinensis)
STRINGXP_006436969.11e-159(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.17e-96floral meristem identity control protein LEAFY (LFY)