PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma279g00090.1
Common NameZOSMA_279G00090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 239aa    MW: 27571.1 Da    PI: 5.6222
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma279g00090.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.29.1e-5561331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeelv++yLk+k++g k+el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++
  Zosma279g00090.1   6 LPPGFRFHPTDEELVHYYLKRKIHGLKIEL-DIIPEVDLYKCEPWELSdKsFLPSKDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRR 97 
                       79****************************.99**************85335556788*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v s +++++g+kktLv+y+grap+g +tdWvmheyrl
  Zosma279g00090.1  98 VSS-QNRVIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                       **9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-634157IPR003441NAC domain
PROSITE profilePS5100559.6036156IPR003441NAC domain
PfamPF023658.6E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MSPVGLPPGF RFHPTDEELV HYYLKRKIHG LKIELDIIPE VDLYKCEPWE LSDKSFLPSK  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVSS QNRVIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKECED TMGIQDSFAL CRVFKKNVVT PNIQQLEDHS SHPDQLPLAD  180
QQLPIIDVGA QTLSPNMQPA QSPSCVDEED DSWMQFITDD AWCSAVSTNE PDLSFSLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-54115715169NAC domain-containing protein 19
3swm_B4e-54115715169NAC domain-containing protein 19
3swm_C4e-54115715169NAC domain-containing protein 19
3swm_D4e-54115715169NAC domain-containing protein 19
3swp_A4e-54115715169NAC domain-containing protein 19
3swp_B4e-54115715169NAC domain-containing protein 19
3swp_C4e-54115715169NAC domain-containing protein 19
3swp_D4e-54115715169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009392206.11e-130PREDICTED: NAC domain-containing protein 86
SwissprotA4VCM04e-88NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A0K9PDJ81e-179A0A0K9PDJ8_ZOSMR; NAC domain protein
STRINGGSMUA_Achr3P13880_0011e-129(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-115NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]