PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma26g01220.1
Common NameZOSMA_26G01220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 263aa    MW: 29798.8 Da    PI: 8.727
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma26g01220.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-5361341128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtd+elv++yLk+kv+gkk+el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat+sgyWkatgkdk++
  Zosma26g01220.1   6 LPPGFRFHPTDDELVSYYLKRKVDGKKIEL-EVIPVIDLYKFDPWELPeKsFLPKRDMEWFFFCTRDRKYPNGSRTNRATQSGYWKATGKDKKI 98 
                      79****************************.99**************95344555788************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++ +++ l+ktLvfy+grap g +tdW+mheyrl
  Zosma26g01220.1  99 VCQEPSVTALRKTLVFYRGRAPAGCRTDWFMHEYRL 134
                      **999*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.2E-563155IPR003441NAC domain
PROSITE profilePS5100554.4536156IPR003441NAC domain
PfamPF023653.8E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MAANCLPPGF RFHPTDDELV SYYLKRKVDG KKIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DMEWFFFCTR DRKYPNGSRT NRATQSGYWK ATGKDKKIVC QEPSVTALRK TLVFYRGRAP  120
AGCRTDWFMH EYRLCEHLLH GSTFVGGFAL SRIVKRSSES GQKAMESLRE SKSKGSHRIN  180
APTQFTDGTS KDLVLPSNLV AISTNEGTSS KNAMDQSSNV CNGHSDIVGS WNHTWSPPIC  240
RQTSGDGICE NFWLPEDTPM VW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51616317171NO APICAL MERISTEM PROTEIN
1ut4_B2e-51616317171NO APICAL MERISTEM PROTEIN
1ut7_A2e-51616317171NO APICAL MERISTEM PROTEIN
1ut7_B2e-51616317171NO APICAL MERISTEM PROTEIN
3swm_A2e-51616320174NAC domain-containing protein 19
3swm_B2e-51616320174NAC domain-containing protein 19
3swm_C2e-51616320174NAC domain-containing protein 19
3swm_D2e-51616320174NAC domain-containing protein 19
3swp_A2e-51616320174NAC domain-containing protein 19
3swp_B2e-51616320174NAC domain-containing protein 19
3swp_C2e-51616320174NAC domain-containing protein 19
3swp_D2e-51616320174NAC domain-containing protein 19
4dul_A2e-51616317171NAC domain-containing protein 19
4dul_B2e-51616317171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028083522.17e-91NAC domain-containing protein 71-like
SwissprotO496977e-80NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A0K9PGK10.0A0A0K9PGK1_ZOSMR; NAC domain protein
STRINGXP_006485436.14e-89(Citrus sinensis)
STRINGXP_006436748.14e-89(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.13e-82NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]