PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma26g00700.1
Common NameZOSMA_26G00700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 181aa    MW: 19749.5 Da    PI: 8.3728
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma26g00700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.62.2e-4361051100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+Cak+C++ap fp+++p+kfa+vhk+FGasnv k+l++lp +er da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +l
  Zosma26g00700.1   6 PCASCKLLRRRCAKECIFAPFFPSDEPHKFAIVHKVFGASNVNKMLQELPIHERADAVSSLVYEANARVRDPVYGCVGAISYLQNQISQLQMQL 99 
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Zosma26g00700.1 100 AVAQAE 105
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.545106IPR004883Lateral organ boundaries, LOB
PfamPF031958.4E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKE CIFAPFFPSD EPHKFAIVHK VFGASNVNKM LQELPIHERA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QISQLQMQLA VAQAEILCIQ MQQESPRPYT  120
SSGSNTTGGI ITANTNNSQK DGSKSFFITN NLTGLPQFIN FSSSANVTQE TLLKRESLWA  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016975.14e-90Lateral organ boundaries domain family protein
SwissprotQ8LBW32e-73LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0K9PED71e-133A0A0K9PED7_Z
STRINGGSMUA_Achr9P18030_0012e-87(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-74LBD family protein