PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma24g01260.1
Common NameZOSMA_24G01260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family ARF
Protein Properties Length: 687aa    MW: 76695.5 Da    PI: 6.5106
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma24g01260.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.51.5e-24119219198
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++ +++a+++       +  ++ +++l+ +d++g +W++k+iyr++++r++lt+GW+ Fv +++L +gD +vF+  + 
  Zosma24g01260.1 119 FCKILTASDTSTHGGFSVLRRHASDClppldmtQ--QTPTQELIAKDLHGYEWRFKHIYRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFM--RG 208
                      99****************************9643..445569************************************************..44 PP

                      SEE..EEEEE- CS
               B3  88 sefelvvkvfr 98 
                      +++el+v+v+r
  Zosma24g01260.1 209 ENGELRVGVRR 219
                      9999*****98 PP

2Auxin_resp94.61.5e-31245324183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha+ t++ F+v+Y+Pr+  s+F++ v+k+ +++k+ +svGmRfkm+fe++d +err++Gt++gv d++ ++W nS WrsLk
  Zosma24g01260.1 245 ASHAFMTHTFFTVYYKPRT--SQFIIDVNKLFDTVKNGFSVGMRFKMRFEGDDTPERRCTGTITGVGDAS-TQWVNSDWRSLK 324
                      68999*************6..9**********************************************55.5*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.5E-41109234IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-41111248IPR015300DNA-binding pseudobarrel domain
CDDcd100176.14E-21117219No hitNo description
PROSITE profilePS5086312.323119221IPR003340B3 DNA binding domain
SMARTSM010196.7E-23119221IPR003340B3 DNA binding domain
PfamPF023621.9E-22119219IPR003340B3 DNA binding domain
PfamPF065071.0E-28245324IPR010525Auxin response factor
PfamPF023096.3E-13570664IPR033389AUX/IAA domain
SuperFamilySSF542771.06E-12570650No hitNo description
PROSITE profilePS5174528.503573666IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MANGSENGDG GDELYQELWK ACAGPLVEMP FVGQKVFYFP QGHMEQLEAS TNQDSDQQIP  60
SFSLPSKIPC RVLDTHLRAE RETDEVYAQI TLLPLPENEL LTTEPNSSEA SRSKKVHSFC  120
KILTASDTST HGGFSVLRRH ASDCLPPLDM TQQTPTQELI AKDLHGYEWR FKHIYRGQPR  180
RHLLTTGWST FVTSKRLVAG DAFVFMRGEN GELRVGVRRL ACQKSVMPSS VISSQSMHLG  240
VLATASHAFM THTFFTVYYK PRTSQFIIDV NKLFDTVKNG FSVGMRFKMR FEGDDTPERR  300
CTGTITGVGD ASTQWVNSDW RSLKVQWDEA TSMQRPERVS PWEIESVDPS TITVAQKPSL  360
TKAKRTRTST CLPISESSSQ FWHPGSILTQ PNNSGGGAVS TEARNCKAQV SAVWSSNPAN  420
DKSNALVFDD GFLNEQRHGQ LSSSTADTSL KLFQGFGREI ETQSFTPWPS FTGSAAENSQ  480
LSNTGIGLEV CKKFENSGGS GLRLFGFELM ADTPISMEEK LVHATAIATG MMDTNNKQIA  540
FTKQSSSELK PRTQHQIYPN EILSKQSCCS STRSRTKVHM QGIVVGRAVD LTILESYEEL  600
ITELEKMFDI KEGELQHRNK WELVYTDDED DMMLVGDDPW LEFCKMVRKI FIYTCDEVKK  660
MKPRSKLHQT ECKVDGDCAT VPASSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-16023487356Auxin response factor 1
4ldw_A1e-16023487356Auxin response factor 1
4ldw_B1e-16023487356Auxin response factor 1
4ldx_A1e-16023487356Auxin response factor 1
4ldx_B1e-16023487356Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266558.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A0K9PGD70.0A0A0K9PGD7_ZOSMR; Auxin response factor
STRINGXP_010266558.10.0(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108236116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9