PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma230g00330.1
Common NameZOSMA_230G00330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family S1Fa-like
Protein Properties Length: 77aa    MW: 8353.05 Da    PI: 10.3974
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma230g00330.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA107.75.8e-341176570
              S1FA  5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                        e++GlnPG +vllvv g +l+f+  n  ly+yaqk+lPP+kkkPvskkklk+eklkqG+++PGe
  Zosma230g00330.1 11 DKESQGLNPGTVVLLVVMGAMLLFIGVNIGLYMYAQKTLPPKKKKPVSKKKLKKEKLKQGISAPGE 76
                      579**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.2E-321276IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MADEFEGNMF DKESQGLNPG TVVLLVVMGA MLLFIGVNIG LYMYAQKTLP PKKKKPVSKK  60
KLKKEKLKQG ISAPGE*
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.29e-22DNA-binding protein S1FA
RefseqXP_024026346.19e-22DNA-binding protein S1FA
SwissprotP425531e-13S1FA1_ORYSJ; DNA-binding protein S1FA1
TrEMBLA0A0K9PKG06e-46A0A0K9PKG0_ZOSMR; DNA-binding protein S1FA1
STRINGXP_010104121.19e-22(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51543563