PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma22g00540.1
Common NameZOSMA_22G00540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family bZIP
Protein Properties Length: 425aa    MW: 45833.4 Da    PI: 7.058
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma22g00540.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1361.5e-11227285563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l +l+    +l+se+
  Zosma22g00540.1 227 KRAKRIWANRQSAARSKERKMRYISELERKVQTLQTEATTLSAQLTMLQRDTTSLTSEN 285
                      9*******************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-16223287IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.174225288IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.09E-11227282No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-11227283No hitNo description
PfamPF001708.7E-10227285IPR004827Basic-leucine zipper domain
CDDcd147037.64E-25228277No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MDKERSPGGG RGLPPFSNSR YSPFPSPTAN FPLKSEASPS SSSSVAAPGS GSNHPGFSQD  60
VSKMPDFPTR NAGHRRAHSE ILCLPDDISF DSDLGVVGGN DLPSLSDEND DDIVSMYMDM  120
EKYVAFSASS AGGLSEGFGN GPSNNVSVNA DTVQGGSIGP SQVESSGAGT SSQRPNRARH  180
QHSQSMDGST SIKTELLGST SDGSSLADSK KAMSAAKLAD LALVDPKRAK RIWANRQSAA  240
RSKERKMRYI SELERKVQTL QTEATTLSAQ LTMLQRDTTS LTSENSELKL RLQTTEQQVR  300
LQDALNDALR DEVQRLKVLT GQPIPNGTQI MNYGSSSFDP TSQPFYPQNH NMQSMLASHQ  360
LQQLNLHSQQ QQQVGHPNHL HQQIPSQHHQ QFQHSEVKIR APATPTNNRL DGSSGASSPS  420
QIKE*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268265.11e-143PREDICTED: probable transcription factor PosF21
RefseqXP_010268266.11e-143PREDICTED: probable transcription factor PosF21
RefseqXP_010268267.11e-143PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-118POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0K9PKK00.0A0A0K9PKK0_ZOSMR; BZIP transcription factor
STRINGXP_010268265.11e-143(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-120bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]