PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma210g00080.1
Common NameZOSMA_210G00080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 193aa    MW: 20953.4 Da    PI: 8.4674
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma210g00080.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.55.7e-4435133199
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC +dCv+apyfp ++p+kfa vhk+FGasnv+kll++l++ +reda++sl+yeA++r+rdP+yG+vgvi+ l+qql+ql+ +
  Zosma210g00080.1  35 PCAACKFLRRKCHPDCVFAPYFPPDNPQKFAHVHKVFGASNVTKLLNELSPYQREDAVNSLAYEADMRLRDPIYGCVGVISILEQQLRQLQID 127
                       7******************************************************************************************** PP

            DUF260  94 lallke 99 
                       la++k 
  Zosma210g00080.1 128 LARAKY 133
                       *99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.50234135IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-4335131IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MRSSASSVTS SSSISTASAF TSSSSSTSSP SPTSPCAACK FLRRKCHPDC VFAPYFPPDN  60
PQKFAHVHKV FGASNVTKLL NELSPYQRED AVNSLAYEAD MRLRDPIYGC VGVISILEQQ  120
LRQLQIDLAR AKYELSKYQT AAATPGVDFF GLGRNNYETA EIGSGNFGFQ FQKPSTTTGV  180
IDEKQNFRPS LN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105838.11e-69LOB domain-containing protein 6
RefseqXP_008673456.11e-69PREDICTED: LOB domain-containing protein 6 isoform X1
SwissprotQ32SG31e-71LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A0K9PKM61e-141A0A0K9PKM6_Z
STRINGMLOC_72525.17e-70(Hordeum vulgare)
STRINGGRMZM2G118250_P034e-69(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.43e-55LBD family protein