PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma208g00340.1
Common NameZOSMA_208G00340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family G2-like
Protein Properties Length: 404aa    MW: 44445.6 Da    PI: 7.1147
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma208g00340.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.2e-31211266156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+p+LHerFv+a++ LGG++ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Zosma208g00340.1 211 KARRCWSPDLHERFVNALNMLGGPQLATPKQIRELMKVNGLTNDEVKSHLQKYRLH 266
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-28208269IPR009057Homeodomain-like
PROSITE profilePS5129414.232208268IPR017930Myb domain
SuperFamilySSF466899.68E-17209269IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-25211266IPR006447Myb domain, plants
PfamPF002492.2E-7213264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MGRSVTTSPH IHGDHLQTSS SQKIEDFLSR LEEERVKIDA FKRELPLCMQ LLNNAMEAYK  60
EQLESYRGEK RTSVLLEEFI PIKKNYDEIQ KVSSNSNNGD GVGTGTGISN MEKSSWMTSV  120
QLWTNDSTTS EATVTPKPAT ESNGTFLPFY KVERSSSSTS NKGNLPDLSL SSLDTVKDDV  180
VPTEGKSNTL SEVHVPTPAA SQGGGTHNHR KARRCWSPDL HERFVNALNM LGGPQLATPK  240
QIRELMKVNG LTNDEVKSHL QKYRLHTRRP NPLMQAPPPG APQLVVLGGI WVPPEYAAAA  300
GATFYGTHPS AHYCATATAN QQYPPHHLHH SHNRQTFNNR SSVMGYNVSE SDVNLSERSM  360
KTGKEDDNEK AVATVGAVKA VVEEREEKSL VSVVDGNDVI LKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-15211264154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-15211264154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-15211264154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-15211264154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254263.12e-96PREDICTED: myb family transcription factor EFM-like
SwissprotQ5VRW23e-81NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLA0A0K9PLA50.0A0A0K9PLA5_ZOSMR; Myb family transcription factor
STRINGXP_010254263.16e-96(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-78G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]