PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma1g03800.1
Common NameZOSMA_1G03800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 253aa    MW: 29101 Da    PI: 10.1813
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma1g03800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.21e-36581571100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+C++dC+lap fpa+qp  f n+h+lFG+sn++kllk+++  e++dam+s+++++++rar Pv G++ vi++lq++l+  +a+la
  Zosma1g03800.1  58 ACAACKHQRRRCQPDCILAPFFPADQPDIFINAHRLFGVSNITKLLKSIDVREHRDAMNSIIFHSDCRARYPVGGCLDVIKNLQNKLDVYNAQLA 152
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      l+e+
  Zosma1g03800.1 153 FLNER 157
                     98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.52657158IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-3558154IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MKMLPIVQTR MNGRSNGPIR RNYRGRSNHV VNQIHPYVDL SKRPPPLLVA TTPTSSHACA  60
ACKHQRRRCQ PDCILAPFFP ADQPDIFINA HRLFGVSNIT KLLKSIDVRE HRDAMNSIIF  120
HSDCRARYPV GGCLDVIKNL QNKLDVYNAQ LAFLNERIAF FQNLGSNSYF IQQQQQQQQQ  180
QQQTITMPNS NSSHHHHHHH RRHQQPTGEA DFLPLLSNVL QQTVKNNQKK EEEEMASNKK  240
IMVHEVDPRQ QS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PQ850.0A0A0K9PQ85_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-34LOB domain-containing protein 22