PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma1g02650.1
Common NameZOSMA_1G02650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 439aa    MW: 49802.9 Da    PI: 6.7511
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma1g02650.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.52.8e-49501921128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk................kvka.eekewyfFskrdkkyatgkrknrat 78 
                     +ppGfrFhPt+eel+++yL+kkv++  ++l +vi++vd++k+ePwd+++                ++ +  +++wyfFs++dkky+tg+r+nrat
  Zosma1g02650.1  50 VPPGFRFHPTEEELLNYYLRKKVASAVIDL-DVIRDVDLNKLEPWDIQEniqmnddgrmdgadkcRIGStPQNDWYFFSHKDKKYPTGTRTNRAT 143
                     69****************************.9***************95588999998888776533223556********************** PP

             NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++g+Wkatg+dk +++ + +  g++ktLvfykgrap+g+k+dW+mheyrl
  Zosma1g02650.1 144 TAGFWKATGRDKVIYT-SLKRLGMRKTLVFYKGRAPHGQKSDWIMHEYRL 192
                     ****************.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-5240227IPR003441NAC domain
PROSITE profilePS5100553.55350227IPR003441NAC domain
PfamPF023654.7E-2751192IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MHFYNLILLL SPLIFIPIHK ISNIQAIHPS NCIFSLLRST RMSVNGESRV PPGFRFHPTE  60
EELLNYYLRK KVASAVIDLD VIRDVDLNKL EPWDIQENIQ MNDDGRMDGA DKCRIGSTPQ  120
NDWYFFSHKD KKYPTGTRTN RATTAGFWKA TGRDKVIYTS LKRLGMRKTL VFYKGRAPHG  180
QKSDWIMHEY RLQEHIQDNN IPQSNVFVGE VMQGQEDGWV VCRVFKKKNH HKSLHAPTSK  240
SSDSVDQILR FFGRSCLSES SIKPYNNFEN SSCSTTTTNN NKDDTYLKHL LPIEICASST  300
KNELLENFNR LPALQSPSTI FSNVCPPQLD RSSYNDPLSD GVQLESHADP YQQQLQQVDP  360
NLHDWATLDQ LVASHLNGQL DVSKQLLCFD DVNNCYEAFC SSTADKMSSH PPEDYNHGGG  420
DTGDMDLWGA FTSGSKLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-445022917167NO APICAL MERISTEM PROTEIN
1ut4_B8e-445022917167NO APICAL MERISTEM PROTEIN
1ut7_A8e-445022917167NO APICAL MERISTEM PROTEIN
1ut7_B8e-445022917167NO APICAL MERISTEM PROTEIN
3swm_A1e-435022920170NAC domain-containing protein 19
3swm_B1e-435022920170NAC domain-containing protein 19
3swm_C1e-435022920170NAC domain-containing protein 19
3swm_D1e-435022920170NAC domain-containing protein 19
3swp_A1e-435022920170NAC domain-containing protein 19
3swp_B1e-435022920170NAC domain-containing protein 19
3swp_C1e-435022920170NAC domain-containing protein 19
3swp_D1e-435022920170NAC domain-containing protein 19
4dul_A8e-445022917167NAC domain-containing protein 19
4dul_B8e-445022917167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940850.11e-139NAC domain-containing protein 43
TrEMBLA0A0K9PMJ00.0A0A0K9PMJ0_ZOSMR; NAC domain-containing protein 43
STRINGXP_008777853.11e-130(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.17e-86NAC family protein