PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma1g00270.1
Common NameZOSMA_1G00270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 197aa    MW: 21138.7 Da    PI: 8.1295
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma1g00270.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.73.6e-4271061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+Ca+dC++ap fp+++p+kfa+vhk+FGasnv+k+l++lp ++r+da+sslvye++ar+rdPvyG+vg i+ lq+ ++ql+ +la
  Zosma1g00270.1   7 PCASCKLLRRRCATDCIFAPFFPSDDPHKFAVVHKVFGASNVSKMLQDLPIQQRPDAVSSLVYESNARMRDPVYGCVGAISYLQNLVSQLQMQLA 101
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Zosma1g00270.1 102 VAQTE 106
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4086107IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-417104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MAGGNSPCAS CKLLRRRCAT DCIFAPFFPS DDPHKFAVVH KVFGASNVSK MLQDLPIQQR  60
PDAVSSLVYE SNARMRDPVY GCVGAISYLQ NLVSQLQMQL AVAQTEILCI QMQQDSSNSP  120
SPVLMHPSAS SSHADEKNNN NNKNNTKNNT ISSSSFILTN NLSGLPQFFN SSAAASAGGP  180
SGNVTQERPT RESLWA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008804108.16e-79PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW35e-69LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0K9PM511e-144A0A0K9PM51_Z
STRINGGSMUA_Achr9P18030_0018e-78(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-69LBD family protein