PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma192g00220.1
Common NameZOSMA_192G00220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 328aa    MW: 36976.1 Da    PI: 5.9141
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma192g00220.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.5e-53101381128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeel+++yL +k+e+++ +++ v i e+d++ +ePwdLp+k+k  + +ewyfF +rd+ky+tg+r+nrat+sgyWkatg+dke
  Zosma192g00220.1  10 LPPGFRFHPTDEELITHYLIRKIEDTTGSFSAVaIGEADMNLSEPWDLPSKAKMaDADEWYFFYERDRKYPTGSRTNRATNSGYWKATGRDKE 102
                       79*************************7777777***************655551556*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++s ++  +g+kktLvfykgrapkg++t+W+mhe+r+
  Zosma192g00220.1 103 IHS-NNGIIGMKKTLVFYKGRAPKGTRTSWIMHEFRM 138
                       ***.8889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-588159IPR003441NAC domain
PROSITE profilePS5100558.14410159IPR003441NAC domain
PfamPF023655.8E-2811138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MKDDEVSIFL PPGFRFHPTD EELITHYLIR KIEDTTGSFS AVAIGEADMN LSEPWDLPSK  60
AKMADADEWY FFYERDRKYP TGSRTNRATN SGYWKATGRD KEIHSNNGII GMKKTLVFYK  120
GRAPKGTRTS WIMHEFRMQP RVNSFCQDDQ WVVCRVFNRK DIKKNTVSPP PPLLYSSPVE  180
TDLITPAKSQ MTGTTQTSSI SCNSYDDYNQ QYQLSLDYSN VSAYFQDKLD NPTSNTPVFF  240
NNLDEYSDLY SDGLPSSVAS HGMIRRHCKL ADQYNYSVLP EPLMGSSNSN GSPATITEYY  300
TGGDGYASSA TPAPKMVDTH SLVNVYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-50316010166NO APICAL MERISTEM PROTEIN
1ut4_B1e-50316010166NO APICAL MERISTEM PROTEIN
1ut7_A1e-50316010166NO APICAL MERISTEM PROTEIN
1ut7_B1e-50316010166NO APICAL MERISTEM PROTEIN
3swm_A2e-50316013169NAC domain-containing protein 19
3swm_B2e-50316013169NAC domain-containing protein 19
3swm_C2e-50316013169NAC domain-containing protein 19
3swm_D2e-50316013169NAC domain-containing protein 19
3swp_A2e-50316013169NAC domain-containing protein 19
3swp_B2e-50316013169NAC domain-containing protein 19
3swp_C2e-50316013169NAC domain-containing protein 19
3swp_D2e-50316013169NAC domain-containing protein 19
3ulx_A2e-5021617170Stress-induced transcription factor NAC1
4dul_A1e-50316010166NAC domain-containing protein 19
4dul_B1e-50316010166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313983.11e-71NAC domain-containing protein 92-like
RefseqNP_001314138.11e-71NAC domain-containing protein 92-like
RefseqXP_012489590.11e-71PREDICTED: NAC domain-containing protein 100
RefseqXP_017627795.11e-71PREDICTED: NAC domain-containing protein 92-like
TrEMBLA0A0K9PRH90.0A0A0K9PRH9_ZOSMR; NAC domain-containing protein 10
STRINGGorai.007G079900.14e-71(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.17e-70NAC domain containing protein 6