PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma18g01070.1
Common NameZOSMA_18G01070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 212aa    MW: 24203.5 Da    PI: 9.8171
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma18g01070.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.49.7e-52171441128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+v+yL+kk++++ +++  +i+ev++yk++Pw+Lp+k+  ++++wyfF++rd+ky++g+r+nra+ sgyWkatg dk+v+s
  Zosma18g01070.1  17 LPPGFRFHPTDEELIVHYLCKKAAHQIFPA-PIIAEVNLYKYDPWTLPEKALFGDDKWYFFTPRDRKYPNGSRPNRAAGSGYWKATGADKPVHS 109
                      79**************************99.88***************8878899*************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++ vg+kk Lvfy+g+ +kg kt+W+mheyrl
  Zosma18g01070.1 110 AgRSKPVGIKKALVFYTGKPSKGIKTNWIMHEYRL 144
                      977888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-6313170IPR003441NAC domain
PROSITE profilePS5100559.63917170IPR003441NAC domain
PfamPF023658.1E-2818144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MGRRMRRNID AEAELNLPPG FRFHPTDEEL IVHYLCKKAA HQIFPAPIIA EVNLYKYDPW  60
TLPEKALFGD DKWYFFTPRD RKYPNGSRPN RAAGSGYWKA TGADKPVHSA GRSKPVGIKK  120
ALVFYTGKPS KGIKTNWIMH EYRLADTDRT VNNTSTLRLD DWVLCRLYNK NKNWEKTSSS  180
DTYETLPAPL SSPETAIDDW FMGLFSSSVP K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-8851763174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020254522.11e-101LOW QUALITY PROTEIN: NAC domain-containing protein 68-like
SwissprotQ52QH46e-92NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLA0A0K9PPK31e-156A0A0K9PPK3_ZOSMR; NAC domain-containing protein 67
STRINGGSMUA_Achr6P32330_0011e-97(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38033775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.18e-90NAC domain containing protein 32
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Taga Y, et al.
    Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4.
    Plant Signal Behav, 2009. 4(8): p. 740-2
    [PMID:19820348]
  3. Xia N, et al.
    Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses.
    Mol. Biol. Rep., 2010. 37(8): p. 3703-12
    [PMID:20213512]
  4. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  5. Nakayama A, et al.
    Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice.
    BMC Plant Biol., 2013. 13: p. 150
    [PMID:24093634]
  6. Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS
    IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice.
    Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60
    [PMID:26766411]